Recombinant Full Length Human CXXC4 Protein, GST-tagged
Cat.No. : | CXXC4-2373HF |
Product Overview : | Human CXXC4 full-length ORF ( NP_079488.1, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 198 amino acids |
Description : | This gene encodes a CXXC-type zinc finger domain-containing protein that functions as an antagonist of the canonical wingless/integrated signaling pathway. The encoded protein negatively regulates wingless/integrated signaling through interaction with the post synaptic density protein/ Drosophila disc large tumor suppressor/ zonula occludens-1 protein domain of Dishevelled, a scaffolding protein required for the stabilization of the transcriptional co-activator beta-catenin. In addition, the CXXC domain of this protein has been shown to bind unmethylated CpG dinucleotides, localize to promoters and CpG islands, and interact with the catalytic domain of methylcytosine dioxygenase ten-eleven-translocation 2, an iron and alpha-ketoglutarate-dependent dioxygenase that modifies the methylation status of DNA. In humans, a mutation in this gene has been associated with development of malignant renal cell carcinoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015] |
Molecular Mass : | 47.4 kDa |
AA Sequence : | MHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAEIMNLPERVGTFSAIPALGGISLPPGVIVMTALHSPAAASAAVTDSAFQIANLADCPQNHSSSSSSSSGGAGGANPAKKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPGTSLERTPVPSAEAFRWFF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CXXC4 CXXC finger protein 4 [ Homo sapiens ] |
Official Symbol | CXXC4 |
Synonyms | CXXC4; CXXC finger protein 4; CXXC-type zinc finger protein 4; Dvl binding protein IDAX (inhibition of the Dvl and Axin complex); IDAX; CXXC finger 4; inhibition of the Dvl and axin complex protein; Dvl-binding protein IDAX (inhibition of the Dvl and Axin complex); MGC149872; |
Gene ID | 80319 |
mRNA Refseq | NM_025212 |
Protein Refseq | NP_079488 |
MIM | 611645 |
UniProt ID | Q9H2H0 |
◆ Recombinant Proteins | ||
CXXC4-4117M | Recombinant Mouse CXXC4 Protein | +Inquiry |
CXXC4-4857H | Recombinant Human CXXC4 protein, GST-tagged | +Inquiry |
CXXC4-11741H | Recombinant Human CXXC4, GST-tagged | +Inquiry |
CXXC4-2373HF | Recombinant Full Length Human CXXC4 Protein, GST-tagged | +Inquiry |
CXXC4-2205H | Recombinant Human CXXC4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXXC4-7150HCL | Recombinant Human CXXC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXXC4 Products
Required fields are marked with *
My Review for All CXXC4 Products
Required fields are marked with *
0
Inquiry Basket