Recombinant Full Length Human CXXC4 Protein, GST-tagged

Cat.No. : CXXC4-2373HF
Product Overview : Human CXXC4 full-length ORF ( NP_079488.1, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 198 amino acids
Description : This gene encodes a CXXC-type zinc finger domain-containing protein that functions as an antagonist of the canonical wingless/integrated signaling pathway. The encoded protein negatively regulates wingless/integrated signaling through interaction with the post synaptic density protein/ Drosophila disc large tumor suppressor/ zonula occludens-1 protein domain of Dishevelled, a scaffolding protein required for the stabilization of the transcriptional co-activator beta-catenin. In addition, the CXXC domain of this protein has been shown to bind unmethylated CpG dinucleotides, localize to promoters and CpG islands, and interact with the catalytic domain of methylcytosine dioxygenase ten-eleven-translocation 2, an iron and alpha-ketoglutarate-dependent dioxygenase that modifies the methylation status of DNA. In humans, a mutation in this gene has been associated with development of malignant renal cell carcinoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]
Molecular Mass : 47.4 kDa
AA Sequence : MHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAEIMNLPERVGTFSAIPALGGISLPPGVIVMTALHSPAAASAAVTDSAFQIANLADCPQNHSSSSSSSSGGAGGANPAKKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPGTSLERTPVPSAEAFRWFF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CXXC4 CXXC finger protein 4 [ Homo sapiens ]
Official Symbol CXXC4
Synonyms CXXC4; CXXC finger protein 4; CXXC-type zinc finger protein 4; Dvl binding protein IDAX (inhibition of the Dvl and Axin complex); IDAX; CXXC finger 4; inhibition of the Dvl and axin complex protein; Dvl-binding protein IDAX (inhibition of the Dvl and Axin complex); MGC149872;
Gene ID 80319
mRNA Refseq NM_025212
Protein Refseq NP_079488
MIM 611645
UniProt ID Q9H2H0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXXC4 Products

Required fields are marked with *

My Review for All CXXC4 Products

Required fields are marked with *

0
cart-icon
0
compare icon