Recombinant Human CYP2A6
Cat.No. : | CYP2A6-27019TH |
Product Overview : | Recombinant fragment corresponding to amino acids 395-494 of Human Cytochrome P450 2A6 with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene, CYP2A6, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by phenobarbital. The enzyme is known to hydroxylate coumarin, and also metabolizes nicotine, aflatoxin B1, nitrosamines, and some pharmaceuticals. Individuals with certain allelic variants are said to have a poor metabolizer phenotype, meaning they do not efficiently metabolize coumarin or nicotine. This gene is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q. The gene was formerly referred to as CYP2A3; however, it has been renamed CYP2A6. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Liver. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LGSVLRDPSFFSNPQDFNPQHFLNEKGQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVGFATIPRNYTMSFLPR |
Sequence Similarities : | Belongs to the cytochrome P450 family. |
Gene Name | CYP2A6 cytochrome P450, family 2, subfamily A, polypeptide 6 [ Homo sapiens ] |
Official Symbol | CYP2A6 |
Synonyms | CYP2A6; cytochrome P450, family 2, subfamily A, polypeptide 6; CYP2A3, cytochrome P450, subfamily IIA (phenobarbital inducible), polypeptide 6; cytochrome P450 2A6; CPA6; CYP2A; |
Gene ID | 1548 |
mRNA Refseq | NM_000762 |
Protein Refseq | NP_000753 |
Uniprot ID | P11509 |
Chromosome Location | 19q13.2 |
Pathway | Biological oxidations, organism-specific biosystem; Caffeine metabolism, organism-specific biosystem; Caffeine metabolism, conserved biosystem; Cytochrome P450 - arranged by substrate type, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; |
Function | aromatase activity; coumarin 7-hydroxylase activity; electron carrier activity; enzyme binding; heme binding; |
◆ Recombinant Proteins | ||
CYP2A6-12H | Active Recombinant Human CYP2A6 Protein | +Inquiry |
CYP2A6-2792H | Recombinant Human CYP2A6 protein, His&Myc-tagged | +Inquiry |
CYP2A6-126H | Recombinant Human CYP2A6, MYC/DDK-tagged | +Inquiry |
CYP2A6-27019TH | Recombinant Human CYP2A6 | +Inquiry |
CYP2A6-2732H | Recombinant Human CYP2A6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP2A6-7117HCL | Recombinant Human CYP2A6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP2A6 Products
Required fields are marked with *
My Review for All CYP2A6 Products
Required fields are marked with *
0
Inquiry Basket