"DDT" Related Products

Expand
Expand
Expand

Recombinant Human DDT Protein, GST-tagged

Cat.No. : DDT-2460H
Product Overview : Human DDT full-length ORF ( AAH05971, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.
Description : D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22. [provided by RefSeq, Jul 2008]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 38.72 kDa
AA Sequence : MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing: :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : DDT D-dopachrome tautomerase [ Homo sapiens ]
Official Symbol : DDT
Synonyms : DDT; D-dopachrome tautomerase; D-dopachrome decarboxylase; D dopachrome decarboxylase; DDCT; phenylpyruvate tautomerase II; FLJ78842;
Gene ID : 1652
mRNA Refseq : NM_001084392
Protein Refseq : NP_001077861
MIM : 602750
UniProt ID : P30046

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.