Recombinant Human DDT Protein, GST-tagged
Cat.No. : | DDT-2460H |
Product Overview : | Human DDT full-length ORF ( AAH05971, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 38.72 kDa |
AA Sequence : | MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DDT D-dopachrome tautomerase [ Homo sapiens ] |
Official Symbol | DDT |
Synonyms | DDT; D-dopachrome tautomerase; D-dopachrome decarboxylase; D dopachrome decarboxylase; DDCT; phenylpyruvate tautomerase II; FLJ78842; |
Gene ID | 1652 |
mRNA Refseq | NM_001084392 |
Protein Refseq | NP_001077861 |
MIM | 602750 |
UniProt ID | P30046 |
◆ Recombinant Proteins | ||
DDT-1001H | Recombinant Human DDT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Ddt-533R | Recombinant Rat Ddt protein(2-118aa), His&V5-tagged | +Inquiry |
Ddt-8231M | Recombinant Mouse Ddt protein, His-tagged | +Inquiry |
DDT-26544TH | Recombinant Human DDT, His-tagged | +Inquiry |
DDT-137H | Recombinant Human DDT protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDT-7022HCL | Recombinant Human DDT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDT Products
Required fields are marked with *
My Review for All DDT Products
Required fields are marked with *