Recombinant Human DDT Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | DDT-1001H | 
| Product Overview : | DDT MS Standard C13 and N15-labeled recombinant protein (NP_001077861) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | DDK&Myc | 
| Description : | D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22. | 
| Molecular Mass : | 12.7 kDa | 
| AA Sequence : | MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFLTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
| Concentration : | 50 μg/mL as determined by BCA | 
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. | 
| Gene Name | DDT D-dopachrome tautomerase [ Homo sapiens (human) ] | 
| Official Symbol | DDT | 
| Synonyms | DDT; D-dopachrome tautomerase; D-dopachrome decarboxylase; D dopachrome decarboxylase; DDCT; phenylpyruvate tautomerase II; FLJ78842; | 
| Gene ID | 1652 | 
| mRNA Refseq | NM_001084392 | 
| Protein Refseq | NP_001077861 | 
| MIM | 602750 | 
| UniProt ID | P30046 | 
| ◆ Recombinant Proteins | ||
| DDT-734H | Recombinant Human D-dopachrome Tautomerase, His-tagged | +Inquiry | 
| DDT-137H | Recombinant Human DDT protein, His-tagged | +Inquiry | 
| DDT-112M | Recombinant Mouse DDT protein, His-tagged | +Inquiry | 
| DDT-1211R | Recombinant Rhesus monkey DDT Protein, His-tagged | +Inquiry | 
| DDT-2505HF | Recombinant Full Length Human DDT Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| DDT-7022HCL | Recombinant Human DDT 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDT Products
Required fields are marked with *
My Review for All DDT Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            