Recombinant Human DDT Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DDT-1001H |
Product Overview : | DDT MS Standard C13 and N15-labeled recombinant protein (NP_001077861) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22. |
Molecular Mass : | 12.7 kDa |
AA Sequence : | MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DDT D-dopachrome tautomerase [ Homo sapiens (human) ] |
Official Symbol | DDT |
Synonyms | DDT; D-dopachrome tautomerase; D-dopachrome decarboxylase; D dopachrome decarboxylase; DDCT; phenylpyruvate tautomerase II; FLJ78842; |
Gene ID | 1652 |
mRNA Refseq | NM_001084392 |
Protein Refseq | NP_001077861 |
MIM | 602750 |
UniProt ID | P30046 |
◆ Recombinant Proteins | ||
DDT-1001H | Recombinant Human DDT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DDT-8705HFL | Recombinant Full Length Human DDT, Flag-tagged | +Inquiry |
DDT-1036R | Recombinant Rhesus Macaque DDT Protein, His (Fc)-Avi-tagged | +Inquiry |
DDT-4396M | Recombinant Mouse DDT Protein | +Inquiry |
DDT-3434H | Recombinant Human DDT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDT-7022HCL | Recombinant Human DDT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDT Products
Required fields are marked with *
My Review for All DDT Products
Required fields are marked with *