Recombinant Rat Ddt protein(2-118aa), His&V5-tagged
| Cat.No. : | Ddt-533R | 
| Product Overview : | Recombinant Rat Ddt protein(P80254)(2-118aa), fused with N-terminal His and C-terminal V5 tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat | 
| Source : | E.coli | 
| Tag : | His&V5 | 
| Protein Length : | 2-118aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 20.5 kDa | 
| Purity : | Greater than 85% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. | 
| AA Sequence : | PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLISSIGVVGTAEQNRSHSSSFFKFLTEELSLDQDRIIIRFFPLEPWQIGKKGTVMTFL | 
| Gene Name | Ddt D-dopachrome tautomerase [ Rattus norvegicus ] | 
| Official Symbol | Ddt | 
| Synonyms | DDT; D-dopachrome tautomerase; D-dopachrome decarboxylase; dopachrome isomerase; | 
| Gene ID | 29318 | 
| mRNA Refseq | NM_024131 | 
| Protein Refseq | NP_077045 | 
| ◆ Recombinant Proteins | ||
| DDT-112M | Recombinant Mouse DDT protein, His-tagged | +Inquiry | 
| DDT-4396M | Recombinant Mouse DDT Protein | +Inquiry | 
| DDT-1815R | Recombinant Rat DDT Protein | +Inquiry | 
| DDT-2460H | Recombinant Human DDT Protein, GST-tagged | +Inquiry | 
| DDT-1534C | Recombinant Canine DDT protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| DDT-7022HCL | Recombinant Human DDT 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ddt Products
Required fields are marked with *
My Review for All Ddt Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            