Recombinant Rat Ddt protein(2-118aa), His&V5-tagged

• Cat.No.: Ddt-533R
• Product Overview: Recombinant Rat Ddt protein(P80254)(2-118aa), fused with N-terminal His and C-terminal V5 tag, was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His&V5
• Protein Length: 2-118aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 20.5 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLISSIGVVGTAEQNRSHSSSFFKFLTEELSLDQDRIIIRFFPLEPWQIGKKGTVMTFL

Gene Information

• Gene Name: Ddt D-dopachrome tautomerase [ Rattus norvegicus ]
• Official Symbol: Ddt
• Synonyms: DDT; D-dopachrome tautomerase; D-dopachrome decarboxylase; dopachrome isomerase
• Gene ID: 29318
• mRNA Refseq: NM_024131
• Protein Refseq: NP_077045