Recombinant Human DES Protein, GST-tagged
Cat.No. : | DES-2549H |
Product Overview : | Human DES full-length ORF (AAH32116.1, 1 a.a. - 470 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in this gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 79.9 kDa |
AA Sequence : | MSQAYSSSQRVSSYRRTFGGAPGFPLGSPLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTRTPSSYGAGELLDFSLADAVNQEFLTTRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DES desmin [ Homo sapiens ] |
Official Symbol | DES |
Synonyms | DES; desmin; CMD1I; CSM1; CSM2; intermediate filament protein; FLJ12025; FLJ39719; FLJ41013; FLJ41793; |
Gene ID | 1674 |
mRNA Refseq | NM_001927 |
Protein Refseq | NP_001918 |
MIM | 125660 |
UniProt ID | P17661 |
◆ Recombinant Proteins | ||
DES-534H | Recombinant Human DES Protein, His-tagged | +Inquiry |
RFL17622BF | Recombinant Full Length Bacillus Subtilis Fatty Acid Desaturase(Des) Protein, His-Tagged | +Inquiry |
DES-1071R | Recombinant Rhesus Macaque DES Protein, His (Fc)-Avi-tagged | +Inquiry |
DES-168H | Recombinant human DES | +Inquiry |
DES-196H | Recombinant Human DES | +Inquiry |
◆ Native Proteins | ||
DES-167C | Native chicken DES | +Inquiry |
◆ Cell & Tissue Lysates | ||
DES-6969HCL | Recombinant Human DES 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DES Products
Required fields are marked with *
My Review for All DES Products
Required fields are marked with *
0
Inquiry Basket