Recombinant Human DES protein(51-460 aa), C-His-tagged
Cat.No. : | DES-2675H |
Product Overview : | Recombinant Human DES protein(P17661)(51-460 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 51-460 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | SRVYQVSRTSGGAGGLGSLRASRLGTTRTPSSYGAGELLDFSLADAVNQEFLTTRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVS |
Gene Name | DES desmin [ Homo sapiens ] |
Official Symbol | DES |
Synonyms | DES; desmin; CMD1I; CSM1; CSM2; intermediate filament protein; FLJ12025; FLJ39719; FLJ41013; FLJ41793; |
Gene ID | 1674 |
mRNA Refseq | NM_001927 |
Protein Refseq | NP_001918 |
MIM | 125660 |
UniProt ID | P17661 |
◆ Recombinant Proteins | ||
Des-3262H | Recombinant Human Des protein, His-tagged | +Inquiry |
DES-11943H | Recombinant Human DES, GST-tagged | +Inquiry |
DES-323H | Recombinant Human DES protein, EGFP-tagged | +Inquiry |
DES-329H | Recombinant Human DES Protein, His-tagged | +Inquiry |
RFL17622BF | Recombinant Full Length Bacillus Subtilis Fatty Acid Desaturase(Des) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
DES-167C | Native chicken DES | +Inquiry |
◆ Cell & Tissue Lysates | ||
DES-6969HCL | Recombinant Human DES 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DES Products
Required fields are marked with *
My Review for All DES Products
Required fields are marked with *
0
Inquiry Basket