Recombinant Human DHODH Protein, GST-tagged
Cat.No. : | DHODH-2590H |
Product Overview : | Human DHODH full-length ORF (1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 43.9 kDa |
AA Sequence : | MVPSHSAPPVCLCSAGMDLTVTGFQWWNTGYGPDSRSRPSSQKLGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSRQDVLEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DHODH dihydroorotate dehydrogenase (quinone) [ Homo sapiens ] |
Official Symbol | DHODH |
Synonyms | DHODH; dihydroorotate dehydrogenase (quinone); dihydroorotate dehydrogenase; dihydroorotate dehydrogenase (quinone), mitochondrial; dihydroorotate oxidase; human complement of yeast URA1; URA1; POADS; DHOdehase; |
Gene ID | 1723 |
mRNA Refseq | NM_001361 |
Protein Refseq | NP_001352 |
MIM | 126064 |
UniProt ID | Q02127 |
◆ Recombinant Proteins | ||
DHODH-11970H | Recombinant Human DHODH protein, GST-tagged | +Inquiry |
DHODH15503H | Recombinant Human DHODH (30-395) Protein, His-tagged | +Inquiry |
DHODH-2541M | Recombinant Mouse DHODH Protein (31-395 aa), His-tagged | +Inquiry |
DHODH-1517R | Recombinant Rat DHODH Protein, His (Fc)-Avi-tagged | +Inquiry |
Dhodh-5850M | Recombinant Mouse Dhodh protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHODH-6944HCL | Recombinant Human DHODH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHODH Products
Required fields are marked with *
My Review for All DHODH Products
Required fields are marked with *