Recombinant Human DNAJB1 Protein, N-6×His-tagged
Cat.No. : | DNAJB1-036H |
Product Overview : | Recombinant human DNAJB1 protein with N-6×His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 340 |
Description : | This gene encodes a member of the DnaJ or Hsp40 (heat shock protein 40 kD) family of proteins. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. The encoded protein is a molecular chaperone that stimulates the ATPase activity of Hsp70 heat-shock proteins in order to promote protein folding and prevent misfolded protein aggregation. Alternative splicing results in multiple transcript variants. |
Form : | Solution |
Molecular Mass : | 40.2 kDa |
AA Sequence : | MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI |
Purity : | > 95% |
Applications : | WB |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | 4°C |
Concentration : | 1 mg/mL |
Storage Buffer : | Tris (pH 8). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | DNAJB1 DnaJ heat shock protein family (Hsp40) member B1 [ Homo sapiens (human) ] |
Official Symbol | DNAJB1 |
Synonyms | DNAJB1; DnaJ heat shock protein family (Hsp40) member B1; Hdj1; Sis1; HSPF1; Hsp40; RSPH16B; dnaJ homolog subfamily B member 1; DnaJ (Hsp40) homolog, subfamily B, member 1; dnaJ protein homolog 1; heat shock 40 kDa protein 1; human DnaJ protein 1; radial spoke 16 homolog B |
Gene ID | 3337 |
mRNA Refseq | NM_006145 |
Protein Refseq | NP_006136 |
MIM | 604572 |
UniProt ID | P25685 |
◆ Recombinant Proteins | ||
DNAJB1-3959HF | Recombinant Full Length Human DNAJB1 Protein, GST-tagged | +Inquiry |
DNAJB1-28381TH | Recombinant Human DNAJB1 | +Inquiry |
Dnajb1-2594M | Recombinant Mouse Dnajb1 Protein, Myc/DDK-tagged | +Inquiry |
DNAJB1-4996H | Recombinant Human DnaJ (Hsp40) Homolog, Subfamily B, Member 1, His-tagged | +Inquiry |
DNAJB1-774H | Recombinant Human DNAJB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAJB1-6892HCL | Recombinant Human DNAJB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAJB1 Products
Required fields are marked with *
My Review for All DNAJB1 Products
Required fields are marked with *
0
Inquiry Basket