Recombinant Full Length Human DNAJB1 Protein, C-Flag-tagged
Cat.No. : | DNAJB1-1382HFL |
Product Overview : | Recombinant Full Length Human DNAJB1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the DnaJ or Hsp40 (heat shock protein 40 kD) family of proteins. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. The encoded protein is a molecular chaperone that stimulates the ATPase activity of Hsp70 heat-shock proteins in order to promote protein folding and prevent misfolded protein aggregation. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 37.9 kDa |
AA Sequence : | MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEE GLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGG FTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKK GWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRT IPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | DNAJB1 DnaJ heat shock protein family (Hsp40) member B1 [ Homo sapiens (human) ] |
Official Symbol | DNAJB1 |
Synonyms | Hdj1; Sis1; HSPF1; Hsp40; RSPH16B |
Gene ID | 3337 |
mRNA Refseq | NM_006145.3 |
Protein Refseq | NP_006136.1 |
MIM | 604572 |
UniProt ID | P25685 |
◆ Recombinant Proteins | ||
DNAJB1-3416H | Recombinant Human DNAJB1 Protein (Met1-Ile340), N-His tagged | +Inquiry |
DNAJB1-5389H | Recombinant Human DnaJ (Hsp40) Homolog, Subfamily B, Member 1 | +Inquiry |
DNAJB1-270H | Recombinant Human DNAJB1 Protein(Gly2-Ile340), C-6×His-tagged | +Inquiry |
DNAJB1-271H | Recombinant Human DNAJB1 protein, His/MBP-tagged | +Inquiry |
DNAJB1-323H | Recombinant Human DnaJ (Hsp40) Homolog, Subfamily B, Member 1, His-tagged; | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAJB1-6892HCL | Recombinant Human DNAJB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNAJB1 Products
Required fields are marked with *
My Review for All DNAJB1 Products
Required fields are marked with *
0
Inquiry Basket