Recombinant Full Length Human DNAJB1 Protein, GST-tagged
Cat.No. : | DNAJB1-3959HF |
Product Overview : | Human DNAJB1 full-length ORF ( AAH19827, 1 a.a. - 340 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 340 amino acids |
Description : | This gene encodes a member of the DnaJ or Hsp40 (heat shock protein 40 kD) family of proteins. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. The encoded protein is a molecular chaperone that stimulates the ATPase activity of Hsp70 heat-shock proteins in order to promote protein folding and prevent misfolded protein aggregation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015] |
Molecular Mass : | 63.14 kDa |
AA Sequence : | MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DNAJB1 DnaJ (Hsp40) homolog, subfamily B, member 1 [ Homo sapiens ] |
Official Symbol | DNAJB1 |
Synonyms | DNAJB1; DnaJ (Hsp40) homolog, subfamily B, member 1; HSPF1; dnaJ homolog subfamily B member 1; Hsp40; radial spoke 16 homolog B (Chlamydomonas); RSPH16B; Sis1; hDj-1; human DnaJ protein 1; heat shock protein 40; dnaJ protein homolog 1; heat shock 40kD protein 1; radial spoke 16 homolog B; heat shock 40 kDa protein 1; DnaJ (Hsp40) homolog, subfmaily B, member 1; Hdj1; |
Gene ID | 3337 |
mRNA Refseq | NM_006145 |
Protein Refseq | NP_006136 |
MIM | 604572 |
UniProt ID | P25685 |
◆ Recombinant Proteins | ||
DNAJB1-272H | Recombinant Human DNAJB1 protein, His/MBP-tagged | +Inquiry |
DNAJB1-12058H | Recombinant Human DNAJB1, GST-tagged | +Inquiry |
DNAJB1-2730H | Recombinant Human DNAJB1 Protein, GST-tagged | +Inquiry |
DNAJB1-3416H | Recombinant Human DNAJB1 Protein (Met1-Ile340), N-His tagged | +Inquiry |
DNAJB1-1382HFL | Recombinant Full Length Human DNAJB1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAJB1-6892HCL | Recombinant Human DNAJB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAJB1 Products
Required fields are marked with *
My Review for All DNAJB1 Products
Required fields are marked with *