Recombinant Human EBI3 Protein, GST-tagged
Cat.No. : | EBI3-2233H |
Product Overview : | Human EBI3 full-length ORF ( AAH15364.1, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 50.71 kDa |
AA Sequence : | MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | EBI3 Epstein-Barr virus induced 3 [ Homo sapiens ] |
Official Symbol | EBI3 |
Synonyms | EBI3; Epstein-Barr virus induced 3; interleukin-27 subunit beta; IL27 subunit; IL35 subunit; cytokine receptor; IL-27 subunit beta; EBV-induced gene 3 protein; Epstein-Barr virus induced gene 3; epstein-Barr virus-induced gene 3 protein; IL27B; IL-27B; |
Gene ID | 10148 |
mRNA Refseq | NM_005755 |
Protein Refseq | NP_005746 |
MIM | 605816 |
UniProt ID | Q14213 |
◆ Recombinant Proteins | ||
EBI3-975HF | Recombinant Full Length Human EBI3 Protein, GST-tagged | +Inquiry |
EBI3-256H | Active Recombinant Human EBI3/p28 protein, His-tagged | +Inquiry |
Ebi3-60M | Recombinant Active Mouse EBI3 Protein, His-tagged(C-ter) | +Inquiry |
EBI3-287H | Recombinant Human EBI3, Fc tagged | +Inquiry |
EBI3-70M | Recombinant Macaque EBI3 subunit (IL-27/IL-35) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EBI3-240HCL | Recombinant Human EBI3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EBI3 Products
Required fields are marked with *
My Review for All EBI3 Products
Required fields are marked with *