Recombinant Human EBI3 Protein, GST-tagged

Cat.No. : EBI3-2233H
Product Overview : Human EBI3 full-length ORF ( AAH15364.1, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 50.71 kDa
AA Sequence : MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name EBI3 Epstein-Barr virus induced 3 [ Homo sapiens ]
Official Symbol EBI3
Synonyms EBI3; Epstein-Barr virus induced 3; interleukin-27 subunit beta; IL27 subunit; IL35 subunit; cytokine receptor; IL-27 subunit beta; EBV-induced gene 3 protein; Epstein-Barr virus induced gene 3; epstein-Barr virus-induced gene 3 protein; IL27B; IL-27B;
Gene ID 10148
mRNA Refseq NM_005755
Protein Refseq NP_005746
MIM 605816
UniProt ID Q14213

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EBI3 Products

Required fields are marked with *

My Review for All EBI3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon