Recombinant Active Mouse EBI3 Protein, His-tagged(C-ter)
Cat.No. : | Ebi3-60M |
Product Overview : | Recombinant Active Mouse EBI3 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells. [provided by RefSeq, Sep 2008] |
Form : | Powder |
Bio-activity : | Determined by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is < 5 ng/mL. |
AA Sequence : | MALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKP |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 95% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | 20 mM Sodium carbonate (pH 4.5) and 0.2M NaCl. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | Ebi3 Epstein-Barr virus induced gene 3 [ Mus musculus ] |
Official Symbol | Ebi3 |
Synonyms | EBI3; Epstein-Barr virus induced gene 3; interleukin-27 subunit beta; IL-27B; IL-27 subunit beta; epstein-Barr virus-induced gene 3 protein homolog; EBI-3; IL-27; |
Gene ID | 50498 |
mRNA Refseq | NM_015766 |
Protein Refseq | NP_056581 |
◆ Recombinant Proteins | ||
EBI3-8522H | Recombinant Human EBI3, His tagged | +Inquiry |
EBI3-70M | Recombinant Macaque EBI3 subunit (IL-27/IL-35) Protein | +Inquiry |
EBI3-45H | Recombinant Human EBI3 | +Inquiry |
EBI3; p28-2829H | Recombinant Human EBI3; p28 Protein, His (Fc)-Avi-tagged | +Inquiry |
EBI3-256H | Active Recombinant Human EBI3/p28 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EBI3-240HCL | Recombinant Human EBI3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EBI3 Products
Required fields are marked with *
My Review for All EBI3 Products
Required fields are marked with *
0
Inquiry Basket