Recombinant Human EFNB1 Protein, GST-tagged
Cat.No. : | EFNB1-3102H |
Product Overview : | Human EFNB1 full-length ORF ( NP_004420.1, 1 a.a. - 346 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 64.4 kDa |
AA Sequence : | MARPGQRWLGKWLVAMVVWALCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EFNB1 ephrin-B1 [ Homo sapiens ] |
Official Symbol | EFNB1 |
Synonyms | EFNB1; ephrin-B1; CFNS, craniofrontonasal syndrome (craniofrontonasal dysplasia) , EPLG2; Elk L; LERK2; EFL-3; LERK-2; ELK ligand; ligand of eph-related kinase 2; eph-related receptor tyrosine kinase ligand 2; CFND; CFNS; EFL3; EPLG2; Elk-L; MGC8782; |
Gene ID | 1947 |
mRNA Refseq | NM_004429 |
Protein Refseq | NP_004420 |
MIM | 300035 |
UniProt ID | P98172 |
◆ Recombinant Proteins | ||
RFL36358RF | Recombinant Full Length Rat Ephrin-B1(Efnb1) Protein, His-Tagged | +Inquiry |
EFNB1-1259H | Recombinant Human EFNB1 protein, hFc&His-tagged | +Inquiry |
Efnb1-1733M | Recombinant Mouse Ephrin B1 | +Inquiry |
EFNB1-9316Z | Recombinant Zebrafish EFNB1 | +Inquiry |
EFNB1-2973H | Recombinant Human EFNB1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNB1-1515RCL | Recombinant Rat EFNB1 cell lysate | +Inquiry |
EFNB1-2537HCL | Recombinant Human EFNB1 cell lysate | +Inquiry |
EFNB1-2152MCL | Recombinant Mouse EFNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EFNB1 Products
Required fields are marked with *
My Review for All EFNB1 Products
Required fields are marked with *
0
Inquiry Basket