Recombinant Full Length Human EFNB1 Protein, GST-tagged
| Cat.No. : | EFNB1-4218HF |
| Product Overview : | Human EFNB1 full-length ORF ( NP_004420.1, 1 a.a. - 346 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 346 amino acids |
| Description : | The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 64.4 kDa |
| AA Sequence : | MARPGQRWLGKWLVAMVVWALCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EFNB1 ephrin-B1 [ Homo sapiens ] |
| Official Symbol | EFNB1 |
| Synonyms | EFNB1; ephrin-B1; CFNS, craniofrontonasal syndrome (craniofrontonasal dysplasia) , EPLG2; Elk L; LERK2; EFL-3; LERK-2; ELK ligand; ligand of eph-related kinase 2; eph-related receptor tyrosine kinase ligand 2; CFND; CFNS; EFL3; EPLG2; Elk-L; MGC8782; |
| Gene ID | 1947 |
| mRNA Refseq | NM_004429 |
| Protein Refseq | NP_004420 |
| MIM | 300035 |
| UniProt ID | P98172 |
| ◆ Recombinant Proteins | ||
| EFNB1-1077R | Active Recombinant Rat EFNB1 Protein, His-tagged | +Inquiry |
| EFNB1-2626H | Active Recombinant Human EFNB1 protein, His-tagged | +Inquiry |
| EFNB1-2238H | Active Recombinant Human EFNB1 protein, His-tagged | +Inquiry |
| Efnb1-181M | Active Recombinant Mouse Efnb1, Fc Chimera | +Inquiry |
| EFNB1-301454H | Recombinant Human EFNB1 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EFNB1-2152MCL | Recombinant Mouse EFNB1 cell lysate | +Inquiry |
| EFNB1-1515RCL | Recombinant Rat EFNB1 cell lysate | +Inquiry |
| EFNB1-2537HCL | Recombinant Human EFNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFNB1 Products
Required fields are marked with *
My Review for All EFNB1 Products
Required fields are marked with *



