Recombinant Human EIF3E Protein (1-445 aa), GST-tagged

Cat.No. : EIF3E-2115H
Product Overview : Recombinant Human EIF3E Protein (1-445 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-445 aa
Description : omponent of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis . The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation . The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression . Required for nonsense-mediated mRNA decay (NMD); may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway . May interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 79.1 kDa
AA Sequence : MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name EIF3E eukaryotic translation initiation factor 3, subunit E [ Homo sapiens ]
Official Symbol EIF3E
Synonyms EIF3E; eIF3 p48; eIF3e; eIF-3 p48; INT6; EIF3S6; EIF3-P48; eIF3-p46;
Gene ID 3646
mRNA Refseq NM_001568
Protein Refseq NP_001559
MIM 602210
UniProt ID P60228

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF3E Products

Required fields are marked with *

My Review for All EIF3E Products

Required fields are marked with *

0
cart-icon
0
compare icon