Recombinant Human EIF3E Protein (1-445 aa), GST-tagged
Cat.No. : | EIF3E-2115H |
Product Overview : | Recombinant Human EIF3E Protein (1-445 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-445 aa |
Description : | omponent of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis . The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation . The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression . Required for nonsense-mediated mRNA decay (NMD); may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway . May interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 79.1 kDa |
AA Sequence : | MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | EIF3E eukaryotic translation initiation factor 3, subunit E [ Homo sapiens ] |
Official Symbol | EIF3E |
Synonyms | EIF3E; eIF3 p48; eIF3e; eIF-3 p48; INT6; EIF3S6; EIF3-P48; eIF3-p46; |
Gene ID | 3646 |
mRNA Refseq | NM_001568 |
Protein Refseq | NP_001559 |
MIM | 602210 |
UniProt ID | P60228 |
◆ Recombinant Proteins | ||
EIF3E-26384TH | Recombinant Human EIF3E | +Inquiry |
EIF3E-2043H | Recombinant Human EIF3E Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EIF3E-2712M | Recombinant Mouse EIF3E Protein, His (Fc)-Avi-tagged | +Inquiry |
Eif3e-2779M | Recombinant Mouse Eif3e Protein, Myc/DDK-tagged | +Inquiry |
EIF3E-1246R | Recombinant Rhesus Macaque EIF3E Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF3E-6662HCL | Recombinant Human EIF3E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF3E Products
Required fields are marked with *
My Review for All EIF3E Products
Required fields are marked with *
0
Inquiry Basket