Recombinant Full Length Human EIF3E Protein, C-Flag-tagged
Cat.No. : | EIF3E-1080HFL |
Product Overview : | Recombinant Full Length Human EIF3E Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables protein N-terminus binding activity. Contributes to translation initiation factor activity. Involved in positive regulation of mRNA binding activity; regulation of gene expression; and translational initiation. Located in cytosol and nucleus. Part of eukaryotic translation initiation factor 3 complex. Colocalizes with PML body. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 52 kDa |
AA Sequence : | MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHAL REKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYE CGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAVMEDLTRLKETIDNNSVSSPLQSLQQ RTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKV IQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQC ISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAM NIEKKLNQNSRSEAPNWATQDSGFYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | EIF3E eukaryotic translation initiation factor 3 subunit E [ Homo sapiens (human) ] |
Official Symbol | EIF3E |
Synonyms | INT6; EIF3S6; EIF3-P48; eIF3-p46 |
Gene ID | 3646 |
mRNA Refseq | NM_001568.3 |
Protein Refseq | NP_001559.1 |
MIM | 602210 |
UniProt ID | P60228 |
◆ Recombinant Proteins | ||
EIF3E-26385TH | Recombinant Human EIF3E | +Inquiry |
EIF3E-143HF | Recombinant Full Length Human EIF3E Protein | +Inquiry |
EIF3E-2043H | Recombinant Human EIF3E Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EIF3E-3179H | Recombinant Human EIF3E Protein, GST-tagged | +Inquiry |
EIF3E-2115H | Recombinant Human EIF3E Protein (1-445 aa), GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF3E-6662HCL | Recombinant Human EIF3E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF3E Products
Required fields are marked with *
My Review for All EIF3E Products
Required fields are marked with *
0
Inquiry Basket