Recombinant Full Length Human EIF3E Protein, GST-tagged

• Cat.No.: EIF3E-4247HF
• Product Overview: Human EIF3S6 full-length ORF ( NP_001559.1, 1 a.a. - 445 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 445 amino acids
• Description: EIF3E (Eukaryotic Translation Initiation Factor 3 Subunit E) is a Protein Coding gene. Among its related pathways are Viral mRNA Translation and Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S. GO annotations related to this gene include poly(A) RNA binding and translation initiation factor activity.
• Molecular Mass: 78.6 kDa
• AA Sequence: MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EIF3E eukaryotic translation initiation factor 3, subunit E [ Homo sapiens ]
• Official Symbol: EIF3E
• Synonyms: EIF3E; eukaryotic translation initiation factor 3, subunit E; EIF3S6, eukaryotic translation initiation factor 3, subunit 6 48kDa , INT6; eukaryotic translation initiation factor 3 subunit E; eIF3 p48; eIF3e; eIF-3 p48; mammary tumor-associated protein INT6; viral integration site protein INT-6 homolog; eukaryotic translation initiation factor 3 subunit 6; murine mammary tumor integration site 6 (oncogene homolog); eukaryotic translation initiation factor 3, subunit 6 48kDa; eukaryotic translation initiation factor 3, subunit 6 (48kD); INT6; EIF3S6; EIF3-P48; eIF3-p46
• Gene ID: 3646
• mRNA Refseq: NM_001568
• Protein Refseq: NP_001559
• MIM: 602210
• UniProt ID: P60228