Recombinant Full Length Human EIF3E Protein, GST-tagged

Cat.No. : EIF3E-4247HF
Product Overview : Human EIF3S6 full-length ORF ( NP_001559.1, 1 a.a. - 445 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 445 amino acids
Description : EIF3E (Eukaryotic Translation Initiation Factor 3 Subunit E) is a Protein Coding gene. Among its related pathways are Viral mRNA Translation and Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S. GO annotations related to this gene include poly(A) RNA binding and translation initiation factor activity.
Molecular Mass : 78.6 kDa
AA Sequence : MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EIF3E eukaryotic translation initiation factor 3, subunit E [ Homo sapiens ]
Official Symbol EIF3E
Synonyms EIF3E; eukaryotic translation initiation factor 3, subunit E; EIF3S6, eukaryotic translation initiation factor 3, subunit 6 48kDa , INT6; eukaryotic translation initiation factor 3 subunit E; eIF3 p48; eIF3e; eIF-3 p48; mammary tumor-associated protein INT6; viral integration site protein INT-6 homolog; eukaryotic translation initiation factor 3 subunit 6; murine mammary tumor integration site 6 (oncogene homolog); eukaryotic translation initiation factor 3, subunit 6 48kDa; eukaryotic translation initiation factor 3, subunit 6 (48kD); INT6; EIF3S6; EIF3-P48; eIF3-p46;
Gene ID 3646
mRNA Refseq NM_001568
Protein Refseq NP_001559
MIM 602210
UniProt ID P60228

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF3E Products

Required fields are marked with *

My Review for All EIF3E Products

Required fields are marked with *

0
cart-icon