Recombinant Human EIF5A, His-tagged

Cat.No. : EIF5A-27179TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-154 of Human eIF5A with an N terminal His tag. Predicted MWt: 18 kDa,
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-154 a.a.
Description : Eukaryotic translation initiation factor 5A-1 is a protein that in humans is encoded by the EIF5A gene.
Conjugation : HIS
Tissue specificity : Expressed in umbilical vein endothelial cells and several cancer cell lines (at protein level).
Form : Lyophilised:Reconstitute with 67 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Thiourea, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKI VEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHN MDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPE GDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK
Sequence Similarities : Belongs to the eIF-5A family.
Full Length : Full L.
Gene Name EIF5A eukaryotic translation initiation factor 5A [ Homo sapiens ]
Official Symbol EIF5A
Synonyms EIF5A; eukaryotic translation initiation factor 5A; eukaryotic translation initiation factor 5A-1; EIF 5A; EIF5A1; MGC99547; MGC104255;
Gene ID 1984
mRNA Refseq NM_001143760
Protein Refseq NP_001137232
MIM 600187
Uniprot ID P63241
Chromosome Location 17p13-p12
Pathway Hypusine synthesis from eIF5A-lysine, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Post-translational modification: gamma carboxylation and hypusine formation, organism-specific biosystem; Post-translational protein modification, organism-specific biosystem; Translation Factors, organism-specific biosystem;
Function RNA binding; U6 snRNA binding; protein N-terminus binding; protein binding; ribosome binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF5A Products

Required fields are marked with *

My Review for All EIF5A Products

Required fields are marked with *

0
cart-icon