Recombinant Human EIF5A, His-tagged
Cat.No. : | EIF5A-27179TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-154 of Human eIF5A with an N terminal His tag. Predicted MWt: 18 kDa, |
- Specification
- Gene Information
- Related Products
Description : | Eukaryotic translation initiation factor 5A-1 is a protein that in humans is encoded by the EIF5A gene. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Expressed in umbilical vein endothelial cells and several cancer cell lines (at protein level). |
Form : | Lyophilised:Reconstitute with 67 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Thiourea, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKI VEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHN MDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPE GDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK |
Sequence Similarities : | Belongs to the eIF-5A family. |
Gene Name : | EIF5A eukaryotic translation initiation factor 5A [ Homo sapiens ] |
Official Symbol : | EIF5A |
Synonyms : | EIF5A; eukaryotic translation initiation factor 5A; eukaryotic translation initiation factor 5A-1; EIF 5A; EIF5A1; MGC99547; MGC104255; |
Gene ID : | 1984 |
mRNA Refseq : | NM_001143760 |
Protein Refseq : | NP_001137232 |
MIM : | 600187 |
Uniprot ID : | P63241 |
Chromosome Location : | 17p13-p12 |
Pathway : | Hypusine synthesis from eIF5A-lysine, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Post-translational modification: gamma carboxylation and hypusine formation, organism-specific biosystem; Post-translational protein modification, organism-specific biosystem; Translation Factors, organism-specific biosystem; |
Function : | RNA binding; U6 snRNA binding; protein N-terminus binding; protein binding; ribosome binding; |
Products Types
◆ Recombinant Protein | ||
Eif5a-2792M | Recombinant Mouse Eif5a Protein, Myc/DDK-tagged | +Inquiry |
EIF5A-273H | Recombinant Human EIF5A protein(Met1-Lys154), His-tagged | +Inquiry |
EIF5A-2726M | Recombinant Mouse EIF5A Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF5A-0710H | Recombinant Human EIF5A Protein (M1-K154), His/Strep tagged | +Inquiry |
EIF5A-1727R | Recombinant Rat EIF5A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
EIF5A-6641HCL | Recombinant Human EIF5A 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket