Recombinant Human EIF5A Protein, GST-tagged
Cat.No. : | EIF5A-3213H |
Product Overview : | Human EIF5A full-length ORF ( NP_001961.1, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | EIF5A (Eukaryotic Translation Initiation Factor 5A) is a Protein Coding gene. Diseases associated with EIF5A include Hiv-1 and Retinitis Pigmentosa 14. Among its related pathways are Gamma carboxylation, hypusine formation and arylsulfatase activation and Metabolism of proteins. GO annotations related to this gene include poly(A) RNA binding and protein N-terminus binding. An important paralog of this gene is EIF5AL1. |
Molecular Mass : | 43.2 kDa |
AA Sequence : | MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EIF5A eukaryotic translation initiation factor 5A [ Homo sapiens ] |
Official Symbol | EIF5A |
Synonyms | EIF5A; eukaryotic translation initiation factor 5A; eukaryotic translation initiation factor 5A-1; EIF 5A; EIF5A1; MGC99547; MGC104255; eIF-4D; eIF-5A1; eIF-5A-1; rev-binding factor; eukaryotic initiation factor 5A; EIF-5A; eIF5AI; |
Gene ID | 1984 |
mRNA Refseq | NM_001143760 |
Protein Refseq | NP_001137232 |
MIM | 600187 |
UniProt ID | P63241 |
◆ Recombinant Proteins | ||
EIF5A-1946HFL | Recombinant Full Length Human EIF5A Protein, C-Flag-tagged | +Inquiry |
EIF5A-2070R | Recombinant Rat EIF5A Protein | +Inquiry |
EIF5A-1727R | Recombinant Rat EIF5A Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF5A-12397Z | Recombinant Zebrafish EIF5A | +Inquiry |
EIF5A-0710H | Recombinant Human EIF5A Protein (M1-K154), His/Strep tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF5A-6641HCL | Recombinant Human EIF5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF5A Products
Required fields are marked with *
My Review for All EIF5A Products
Required fields are marked with *