Recombinant Human ESR1, StrepII-tagged
Cat.No. : | ESR1-227H |
Product Overview : | Purified human recombinant Estrogen receptor or ER protein (amino acids 2-181, 180 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 19.4 kDa. (Accession NP_000116.2; UniProt P03372) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 2-181, 180 a.a. |
Description : | This product is the N-terminal region of estrogen receptor. ER is a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | TMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQT GLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYR PNSDNRRQGGRERLASTNDKGSMAMESAKE |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >95% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | ESR1 estrogen receptor 1 [ Homo sapiens ] |
Official Symbol | ESR1 |
Synonyms | ESR1; estrogen receptor 1; ESR; estrogen receptor; Era; NR3A1; ER-alpha; estradiol receptor; estrogen nuclear receptor alpha; estrogen receptor alpha delta 4 +49 isoform; nuclear receptor subfamily 3 group A member 1; estrogen receptor alpha 3*,4,5,6,7*/822 isoform; estrogen receptor alpha delta 4*,5,6,7*/654 isoform; estrogen receptor alpha delta 4*,5,6,7,8*/901 isoform; estrogen receptor alpha delta 3*,4,5,6,7*/819-2 isoform; estrogen receptor alpha delta 3*,4,5,6,7*,8*/941 isoform; ER; ESRA; DKFZp686N23123; |
Gene ID | 2099 |
mRNA Refseq | NM_000125 |
Protein Refseq | NP_000116 |
UniProt ID | P03372 |
Chromosome Location | 6q24-q27 |
Pathway | Androgen Receptor Signaling Pathway, organism-specific biosystem; Endocrine and other factor-regulated calcium reabsorption, organism-specific biosystem; Endocrine and other factor-regulated calcium reabsorption, conserved biosystem; Estrogen signaling pathway, organism-specific biosystem; FOXA1 transcription factor network, organism-specific biosystem; FOXM1 transcription factor network, organism-specific biosystem; Gene Expression, organism-specific biosystem; |
Function | DNA binding; beta-catenin binding; chromatin binding; core promoter sequence-specific DNA binding; enzyme binding; enzyme binding; estrogen receptor activity; estrogen receptor activity; estrogen response element binding; hormone binding; identical protein binding; ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity; metal ion binding; nitric-oxide synthase regulator activity; protein binding; protein complex binding; receptor activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; steroid binding; steroid hormone receptor activity; steroid hormone receptor activity; transcription factor binding; type 1 metabotropic glutamate receptor binding; zinc ion binding; |
◆ Recombinant Proteins | ||
ESR1-1390H | Recombinant Human ESR1 Protein (10-595 aa), His-tagged | +Inquiry |
ESR1-118H | Recombinant Human ESR1 protein, His-tagged | +Inquiry |
ESR1-2416H | Recombinant Human ESR1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ESR1-01H | Recombinant Human Estrogen Receptor 1, His-tagged | +Inquiry |
ESR1-27977TH | Recombinant Human ESR1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ESR1-6540HCL | Recombinant Human ESR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ESR1 Products
Required fields are marked with *
My Review for All ESR1 Products
Required fields are marked with *
0
Inquiry Basket