| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
Met297-Ser554 |
| Form : |
Lyophilized from sterile 20 mM Tris, 150 mM NaCl, pH 8.0, containing 1 mM EDTA, 1 mM DTT, 0.01 % SKL, 5 % Trehalose and Proclin 300. |
| Molecular Mass : |
33 kDa |
| AA Sequence : |
MIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVIDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTS |
| Endotoxin : |
<1.0EU per 1µg (determined by the LAL method) |
| Purity : |
> 90 % |
| Applications : |
Positive Control; Immunogen; SDS-PAGE; WB. |
| Notes : |
The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures. |
| Stability : |
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48 h, and no obvious degradation and precipitation were observed. The loss rate is less than 5 % within the expiration date under appropriate storage condition. |
| Storage : |
Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months. |
| Reconstitution : |
Reconstitute in 20 mM Tris, 150 mM NaCl (Ph 8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
