Recombinant Human ESR1 protein, His-tagged

Cat.No. : ESR1-118H
Product Overview : Recombinant Human ESR1 is produced by E.coli expression system and the residues Met297-Ser554 is expressed with a His tag at the N-terminal.
Availability November 09, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Met297-Ser554
Form : Lyophilized from sterile 20 mM Tris, 150 mM NaCl, pH 8.0, containing 1 mM EDTA, 1 mM DTT, 0.01 % SKL, 5 % Trehalose and Proclin 300.
Molecular Mass : 33 kDa
AA Sequence : MIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVIDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTS
Endotoxin : <1.0EU per 1µg (determined by the LAL method)
Purity : > 90 %
Applications : Positive Control; Immunogen; SDS-PAGE; WB.
Notes : The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures.
Stability : The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48 h, and no obvious degradation and precipitation were observed. The loss rate is less than 5 % within the expiration date under appropriate storage condition.
Storage : Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months.
Reconstitution : Reconstitute in 20 mM Tris, 150 mM NaCl (Ph 8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Gene Name ESR1 estrogen receptor 1 [ Homo sapiens ]
Official Symbol ESR1
Synonyms ER-A1; ER; ESR; ESR1; ESRA; NR3A1; NR3-A1; Estrogen Receptor 1;
Gene ID 2099
mRNA Refseq NM_000125
Protein Refseq NP_000116
UniProt ID P03372

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ESR1 Products

Required fields are marked with *

My Review for All ESR1 Products

Required fields are marked with *

0
cart-icon
0
compare icon