Recombinant Human ESR1 protein, His-tagged
Cat.No. : | ESR1-118H |
Product Overview : | Recombinant Human ESR1 is produced by E.coli expression system and the residues Met297-Ser554 is expressed with a His tag at the N-terminal. |
Availability | May 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Met297-Ser554 |
Form : | Lyophilized from sterile 20 mM Tris, 150 mM NaCl, pH 8.0, containing 1 mM EDTA, 1 mM DTT, 0.01 % SKL, 5 % Trehalose and Proclin 300. |
Molecular Mass : | 33 kDa |
AA Sequence : | MIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVIDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTS |
Endotoxin : | <1.0EU per 1µg (determined by the LAL method) |
Purity : | > 90 % |
Applications : | Positive Control; Immunogen; SDS-PAGE; WB. |
Notes : | The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures. |
Stability : | The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48 h, and no obvious degradation and precipitation were observed. The loss rate is less than 5 % within the expiration date under appropriate storage condition. |
Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months. |
Reconstitution : | Reconstitute in 20 mM Tris, 150 mM NaCl (Ph 8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
Gene Name | ESR1 estrogen receptor 1 [ Homo sapiens ] |
Official Symbol | ESR1 |
Synonyms | ER-A1; ER; ESR; ESR1; ESRA; NR3A1; NR3-A1; Estrogen Receptor 1; |
Gene ID | 2099 |
mRNA Refseq | NM_000125 |
Protein Refseq | NP_000116 |
UniProt ID | P03372 |
◆ Recombinant Proteins | ||
ESR1-118H | Recombinant Human ESR1 protein, His-tagged | +Inquiry |
ESR1-13HFL | Recombinant Human ESR1 Protein, Full Length, N-FLAG tagged | +Inquiry |
Esr1-1439R | Recombinant Rat Esr1 protein, His & GST-tagged | +Inquiry |
ESR1-2534H | Recombinant Human ESR1 protein(191-270 aa), C-His-tagged | +Inquiry |
ESR1-6738C | Recombinant Chicken ESR1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ESR1-6540HCL | Recombinant Human ESR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ESR1 Products
Required fields are marked with *
My Review for All ESR1 Products
Required fields are marked with *
0
Inquiry Basket