Recombinant Human FDCSP Protein, GST-tagged

Cat.No. : FDCSP-4056H
Product Overview : Human FDCSP full-length ORF (AAH62213.1, 1 a.a. - 85 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FDCSP is expressed by follicular dendritic cells (FDCs) and activated leukocytes during ongoing immune responses.[supplied by OMIM
Molecular Mass : 35.75 kDa
AA Sequence : MKKVLLLITAILAVAVGFPVSQDQEREKRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPLPSEK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FDCSP follicular dendritic cell secreted protein [ Homo sapiens ]
Official Symbol FDCSP
Synonyms C4orf7; FDC-SP; Follicular Dendritic Cell Secreted Protein; FDC Secreted Protein; Follicular Dendritic Cell Secreted Peptide; Chromosome 4 Open Reading Frame; FDCSP; follicular dendritic cell secreted protein
Gene ID 260436
mRNA Refseq NM_152997
Protein Refseq NP_694542
MIM 607241
UniProt ID Q8NFU4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FDCSP Products

Required fields are marked with *

My Review for All FDCSP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon