Recombinant Human FDCSP Protein, GST-tagged
Cat.No. : | FDCSP-4056H |
Product Overview : | Human FDCSP full-length ORF (AAH62213.1, 1 a.a. - 85 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FDCSP is expressed by follicular dendritic cells (FDCs) and activated leukocytes during ongoing immune responses.[supplied by OMIM |
Molecular Mass : | 35.75 kDa |
AA Sequence : | MKKVLLLITAILAVAVGFPVSQDQEREKRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPLPSEK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FDCSP follicular dendritic cell secreted protein [ Homo sapiens ] |
Official Symbol | FDCSP |
Synonyms | C4orf7; FDC-SP; Follicular Dendritic Cell Secreted Protein; FDC Secreted Protein; Follicular Dendritic Cell Secreted Peptide; Chromosome 4 Open Reading Frame; FDCSP; follicular dendritic cell secreted protein |
Gene ID | 260436 |
mRNA Refseq | NM_152997 |
Protein Refseq | NP_694542 |
MIM | 607241 |
UniProt ID | Q8NFU4 |
◆ Recombinant Proteins | ||
FDCSP-4056H | Recombinant Human FDCSP Protein, GST-tagged | +Inquiry |
FDCSP-4773HF | Recombinant Full Length Human FDCSP Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FDCSP-8021HCL | Recombinant Human C4orf7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FDCSP Products
Required fields are marked with *
My Review for All FDCSP Products
Required fields are marked with *
0
Inquiry Basket