Recombinant Full Length Human FDCSP Protein, GST-tagged
| Cat.No. : | FDCSP-4773HF |
| Product Overview : | Human FDCSP full-length ORF (AAH62213.1, 1 a.a. - 85 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 85 amino acids |
| Description : | FDCSP is expressed by follicular dendritic cells (FDCs) and activated leukocytes during ongoing immune responses.[supplied by OMIM |
| Molecular Mass : | 35.75 kDa |
| AA Sequence : | MKKVLLLITAILAVAVGFPVSQDQEREKRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPLPSEK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FDCSP follicular dendritic cell secreted protein [ Homo sapiens ] |
| Official Symbol | FDCSP |
| Synonyms | C4orf7; FDC-SP; Follicular Dendritic Cell Secreted Protein; FDC Secreted Protein; Follicular Dendritic Cell Secreted Peptide; Chromosome 4 Open Reading Frame; FDCSP; follicular dendritic cell secreted protein |
| Gene ID | 260436 |
| mRNA Refseq | NM_152997 |
| Protein Refseq | NP_694542 |
| MIM | 607241 |
| UniProt ID | Q8NFU4 |
| ◆ Recombinant Proteins | ||
| FDCSP-4773HF | Recombinant Full Length Human FDCSP Protein, GST-tagged | +Inquiry |
| FDCSP-4056H | Recombinant Human FDCSP Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FDCSP-8021HCL | Recombinant Human C4orf7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FDCSP Products
Required fields are marked with *
My Review for All FDCSP Products
Required fields are marked with *
