Recombinant Human FGF10 protein

Cat.No. : FGF10-26205TH
Product Overview : Recombinant Human FGF10 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 169
Description : Fibroblast growth factor 10 belongs to the fibroblast growth factor (FGF) family which is involved in a variety of biological processes such as embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. Like most other FGF family members, FGF-10 also has a heparin-binding domain and it plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. In addition, FGF-10 may play a role in wound healing and is required for normal branching morphogenesis. Recombinant human FGF-10 contains a 208 amino acids and it shares 92 % and 95 % amino acid sequence identity with murine and rat FGF-10. Defects in FGF-10 are the cause of autosomal dominant aplasia of lacrimal and salivary glands and lacrimo-auriculo-dento-digital syndrome.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg.
Molecular Mass : Approximately 19.1 kDa, a single, non-glycosylated polypeptide chain containing 169 amino acids.
AA Sequence : LGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
Endotoxin : Less than 1 EU/µg of rHuKGF-2/FGF-10 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name FGF10
Official Symbol FGF10
Synonyms FGF10; fibroblast growth factor 10; FGF-10; keratinocyte growth factor 2; produced by fibroblasts of urinary bladder lamina propria;
Gene ID 2255
mRNA Refseq NM_004465
Protein Refseq NP_004456
MIM 602115
UniProt ID O15520

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF10 Products

Required fields are marked with *

My Review for All FGF10 Products

Required fields are marked with *

0
cart-icon