Recombinant Human FGF10 protein
Cat.No. : | FGF10-26205TH |
Product Overview : | Recombinant Human FGF10 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 169 |
Description : | Fibroblast growth factor 10 belongs to the fibroblast growth factor (FGF) family which is involved in a variety of biological processes such as embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. Like most other FGF family members, FGF-10 also has a heparin-binding domain and it plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. In addition, FGF-10 may play a role in wound healing and is required for normal branching morphogenesis. Recombinant human FGF-10 contains a 208 amino acids and it shares 92 % and 95 % amino acid sequence identity with murine and rat FGF-10. Defects in FGF-10 are the cause of autosomal dominant aplasia of lacrimal and salivary glands and lacrimo-auriculo-dento-digital syndrome. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg. |
Molecular Mass : | Approximately 19.1 kDa, a single, non-glycosylated polypeptide chain containing 169 amino acids. |
AA Sequence : | LGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS |
Endotoxin : | Less than 1 EU/µg of rHuKGF-2/FGF-10 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | FGF10 |
Official Symbol | FGF10 |
Synonyms | FGF10; fibroblast growth factor 10; FGF-10; keratinocyte growth factor 2; produced by fibroblasts of urinary bladder lamina propria; |
Gene ID | 2255 |
mRNA Refseq | NM_004465 |
Protein Refseq | NP_004456 |
MIM | 602115 |
UniProt ID | O15520 |
◆ Recombinant Proteins | ||
FGF10-15H | Active Recombinant Human FGF10 protein | +Inquiry |
FGF10-6743H | Recombinant Human FGF10 protein, Biotinylated(Primary Amine Labeling) | +Inquiry |
FGF10-422F | Active Recombinant Human FGF10 Protein (187 aa), N-His-tagged | +Inquiry |
Fgf10-420F | Active Recombinant Mouse Fgf10 Protein (148 aa) | +Inquiry |
FGF10-232H | Recombinant Human FGF10 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF10-6251HCL | Recombinant Human FGF10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF10 Products
Required fields are marked with *
My Review for All FGF10 Products
Required fields are marked with *
0
Inquiry Basket