Recombinant Human FGF22 Protein

Cat.No. : FGF22-86H
Product Overview : Recombinant Human FGF22 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Fibroblast growth factor 22 (FGF-22) is a mediator of synaptogenesis in the adult nervous system and functions to regulate synapse formation and maturation. FGF-22 is expressed in the inner hair cell and functions to maintain ribbon synapse number to protect functional hearing. In the hippocampus, FGF-22 promotes excitatory synapse formation through binding the FGFR2b and FGFR1b receptors. FGF-22 is also required for axonal circuit remodeling after spinal cord injury.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 17.3 kDa (149 aa)
AA Sequence : MTPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name FGF22 fibroblast growth factor 22 [ Homo sapiens (human) ]
Official Symbol FGF22
Synonyms FGF22; fibroblast growth factor 22; FGF-22;
Gene ID 27006
mRNA Refseq NM_020637
Protein Refseq NP_065688
MIM 605831
UniProt ID Q9HCT0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF22 Products

Required fields are marked with *

My Review for All FGF22 Products

Required fields are marked with *

0
cart-icon