Recombinant Human FGF7, StrepII-tagged
Cat.No. : | FGF7-218H |
Product Overview : | Purified, full-length human recombinant Fibroblast growth factor 7 or FGF7 protein (amino acids 32-194, 163 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 18.9 kDa. (Accession NP_002000.1; UniProt P21781) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 32-194, 163 a.a. |
Description : | FGF7 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth. and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development, and early lung organogenesis. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVG IVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKK EQKTAHFLPMAIT |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >95% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | FGF7 fibroblast growth factor 7 [ Homo sapiens ] |
Official Symbol | FGF7 |
Synonyms | FGF7; fibroblast growth factor 7; fibroblast growth factor 7 (keratinocyte growth factor); keratinocyte growth factor; KGF; FGF-7; heparin-binding growth factor 7; HBGF-7; |
Gene ID | 2252 |
mRNA Refseq | NM_002009 |
Protein Refseq | NP_002000 |
MIM | 148180 |
UniProt ID | P21781 |
Chromosome Location | 15q21.2 |
Pathway | Downstream signaling of activated FGFR, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; FGFR2 ligand binding and activation, organism-specific biosystem; FGFR2b ligand binding and activation, organism-specific biosystem; FRS2-mediated cascade, organism-specific biosystem; Glypican 3 network, organism-specific biosystem; IRS-mediated signalling, organism-specific biosystem; |
Function | chemoattractant activity; growth factor activity; heparin binding; type 2 fibroblast growth factor receptor binding; |
◆ Recombinant Proteins | ||
FGF7-90H | Active Recombinant Human FGF7 Protein | +Inquiry |
Fgf7-500M | Recombinant Mouse Fgf7 protein(Cys32-Thr194), His-tagged | +Inquiry |
FGF7-28647TH | Recombinant Human FGF7 protein | +Inquiry |
FGF7-189H | Recombinant Human FGF7 protein, His/S-tagged | +Inquiry |
FGF7-6333H | Recombinant Human FGF7 protein, For Organoid Culture | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF7-6236HCL | Recombinant Human FGF7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF7 Products
Required fields are marked with *
My Review for All FGF7 Products
Required fields are marked with *
0
Inquiry Basket