Active Recombinant Human FGF7 Protein
Cat.No. : | FGF7-90H |
Product Overview : | Recombinant Human FGF7 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Fibroblast growth factor 7 (FGF-7), also known as keratinocyte growth factor (KGF), is a potent mitogen that regulates epithelial cell migration and differentiation. FGF-7 is produced by mesenchymal cells and binds in high affinity to a splice variant of FGF receptor 2 (FGFR2-IIIb). The mitogenic activity of FGF-7 acts predominantly on keratinocytes, but not on fibroblast or endothelial cells. FGF-7 expression is upregulated after acute and chronic injury, suggesting that FGF-7 functions during the healing of injured epithelial cells. FGF-7 also induces the formation of the apical ectodermal ridge during limb development. |
Bio-activity : | 4MBr-5 cell proliferation, ≤60 ng/mL; ≥1.7 x 10^4 units/mg |
Molecular Mass : | Monomer, 19 kDa (164 aa) |
AA Sequence : | MCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥90%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 100 mM sodium chloride, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | FGF7 fibroblast growth factor 7 [ Homo sapiens (human) ] |
Official Symbol | FGF7 |
Synonyms | FGF7; fibroblast growth factor 7; fibroblast growth factor 7 (keratinocyte growth factor); keratinocyte growth factor; KGF; FGF-7; heparin-binding growth factor 7; HBGF-7; |
Gene ID | 2252 |
mRNA Refseq | NM_002009 |
Protein Refseq | NP_002000 |
MIM | 148180 |
UniProt ID | P21781 |
◆ Recombinant Proteins | ||
FGF7-057H | Recombinant Human FGF7 Protein | +Inquiry |
FGF7-188H | Recombinant Human FGF7 protein | +Inquiry |
Fgf7-2999M | Recombinant Mouse Fgf7 Protein, Myc/DDK-tagged | +Inquiry |
FGF7-1701R | Recombinant Rhesus monkey FGF7 Protein, His-tagged | +Inquiry |
FGF7-087H | Active Recombinant Human FGF7 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF7-6236HCL | Recombinant Human FGF7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF7 Products
Required fields are marked with *
My Review for All FGF7 Products
Required fields are marked with *
0
Inquiry Basket