Recombinant Human FGL2 Protein, GST-tagged
Cat.No. : | FGL2-4153H |
Product Overview : | Human FGL2 full-length ORF ( NP_006673.1, 1 a.a. - 439 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites. [provided by RefSeq |
Molecular Mass : | 76.6 kDa |
AA Sequence : | MKLANWYWLSSAVLATYGFLVVANNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FGL2 fibrinogen-like 2 [ Homo sapiens ] |
Official Symbol | FGL2 |
Synonyms | FGL2; fibrinogen-like 2; fibroleukin; pT49; T49; fibrinogen-like protein 2; |
Gene ID | 10875 |
mRNA Refseq | NM_006682 |
Protein Refseq | NP_006673 |
MIM | 605351 |
UniProt ID | Q14314 |
◆ Recombinant Proteins | ||
FGL2-01H | Active Recombinant Human FGL2 Protein, His-tagged | +Inquiry |
FGL2-3445H | Recombinant Human FGL2 Protein (Ile209-Pro439), N-His tagged | +Inquiry |
Fgl2-3007M | Recombinant Mouse Fgl2 Protein, Myc/DDK-tagged | +Inquiry |
FGL2-3153Z | Recombinant Zebrafish FGL2 | +Inquiry |
FGL2-1463H | Recombinant Human FGL2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGL2-622HCL | Recombinant Human FGL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGL2 Products
Required fields are marked with *
My Review for All FGL2 Products
Required fields are marked with *
0
Inquiry Basket