Recombinant Human FIZ1 Protein, GST-tagged
Cat.No. : | FIZ1-4180H |
Product Overview : | Human FIZ1 full-length ORF (BAB55286.1, 1 a.a. - 496 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes zinc finger protein, which interacts with a receptor tyrosine kinase involved in the regulation of hematopoietic and lymphoid cells. This gene product also interacts with a transcription factor that regulates the expression of rod-specific genes in retina. [provided by RefSeq |
Molecular Mass : | 78.4 kDa |
AA Sequence : | MDDVPAPTPAPAPPAAAAPRVPFHCSECGKSFRYRSDLRRHFARHTALKPHACPRCGKGFKHSFNLANHLRSHTGERPYRCSACPKGFRDSTGLLHHQVVHTGEKPYCCLVCELRFSSRSSLGRHLRRQHRGVLPSPLQPGPGLPALSAPCSVCCNVGPCSVCGGSGAGGGEGPEGAGAGLGSWGLAEAAAAAAASLPPFACGACARRFDHGRELAAHWAAHTDVKPFKCPRCERDFNAPALLERHKLTHDLQGPGAPPAQAWAAGPGAGPETAGEGTAAEAGDAPLASDRRLLLGPAGGGVPKLGGLLPEGGGEAPAPAAAAEPSEDTLYQCDCGTFFASAAALASHLEAHSGPATYGCGHCGALYAALAALEEHRRVSHGEGGGEEAAAAARKREPASGEPPSGSGRGKKIFGCSECEKLFRSPRDLERHVLVHTGEKPFPCLECGKFFRHECYLKRHRLLHGTERPFPCHICGKGFITLSNLSRHLKLHRGMD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FIZ1 FLT3-interacting zinc finger 1 [ Homo sapiens ] |
Official Symbol | FIZ1 |
Synonyms | FIZ1; FLT3-interacting zinc finger 1; flt3-interacting zinc finger protein 1; FLJ14768; ZNF798; zinc finger protein 798; FLJ00416; |
Gene ID | 84922 |
mRNA Refseq | NM_032836 |
Protein Refseq | NP_116225 |
MIM | 609133 |
UniProt ID | Q96SL8 |
◆ Recombinant Proteins | ||
FIZ1-5116HF | Recombinant Full Length Human FIZ1 Protein, GST-tagged | +Inquiry |
FIZ1-4180H | Recombinant Human FIZ1 Protein, GST-tagged | +Inquiry |
FIZ1-6201H | Recombinant Human FIZ1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Fiz1-3018M | Recombinant Mouse Fiz1 Protein, Myc/DDK-tagged | +Inquiry |
FIZ1-4254H | Recombinant Human FIZ1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FIZ1-6214HCL | Recombinant Human FIZ1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FIZ1 Products
Required fields are marked with *
My Review for All FIZ1 Products
Required fields are marked with *
0
Inquiry Basket