Recombinant Full Length Human FIZ1 Protein, GST-tagged
| Cat.No. : | FIZ1-5116HF |
| Product Overview : | Human FIZ1 full-length ORF (BAB55286.1, 1 a.a. - 496 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 496 amino acids |
| Description : | This gene encodes zinc finger protein, which interacts with a receptor tyrosine kinase involved in the regulation of hematopoietic and lymphoid cells. This gene product also interacts with a transcription factor that regulates the expression of rod-specific genes in retina. [provided by RefSeq |
| Molecular Mass : | 78.4 kDa |
| AA Sequence : | MDDVPAPTPAPAPPAAAAPRVPFHCSECGKSFRYRSDLRRHFARHTALKPHACPRCGKGFKHSFNLANHLRSHTGERPYRCSACPKGFRDSTGLLHHQVVHTGEKPYCCLVCELRFSSRSSLGRHLRRQHRGVLPSPLQPGPGLPALSAPCSVCCNVGPCSVCGGSGAGGGEGPEGAGAGLGSWGLAEAAAAAAASLPPFACGACARRFDHGRELAAHWAAHTDVKPFKCPRCERDFNAPALLERHKLTHDLQGPGAPPAQAWAAGPGAGPETAGEGTAAEAGDAPLASDRRLLLGPAGGGVPKLGGLLPEGGGEAPAPAAAAEPSEDTLYQCDCGTFFASAAALASHLEAHSGPATYGCGHCGALYAALAALEEHRRVSHGEGGGEEAAAAARKREPASGEPPSGSGRGKKIFGCSECEKLFRSPRDLERHVLVHTGEKPFPCLECGKFFRHECYLKRHRLLHGTERPFPCHICGKGFITLSNLSRHLKLHRGMD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FIZ1 FLT3-interacting zinc finger 1 [ Homo sapiens ] |
| Official Symbol | FIZ1 |
| Synonyms | FIZ1; FLT3-interacting zinc finger 1; flt3-interacting zinc finger protein 1; FLJ14768; ZNF798; zinc finger protein 798; FLJ00416; |
| Gene ID | 84922 |
| mRNA Refseq | NM_032836 |
| Protein Refseq | NP_116225 |
| MIM | 609133 |
| UniProt ID | Q96SL8 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FIZ1 Products
Required fields are marked with *
My Review for All FIZ1 Products
Required fields are marked with *




