Recombinant Human FKBP1A Protein, GST-tagged
Cat.No. : | FKBP1A-4186H |
Product Overview : | Human FKBP1A full-length ORF ( AAH05147, 1 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium. Multiple alternatively spliced variants, encoding the same protein, have been identified. The human genome contains five pseudogenes related to this gene, at least one of which is transcribed. [provided by RefSeq |
Molecular Mass : | 37.62 kDa |
AA Sequence : | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FKBP1A FK506 binding protein 1A, 12kDa [ Homo sapiens ] |
Official Symbol | FKBP1A |
Synonyms | FKBP1A; FK506 binding protein 1A, 12kDa; FK506 binding protein 1A (12kD), FKBP1; peptidyl-prolyl cis-trans isomerase FKBP1A; FKBP 12; FKBP12; FKBP12C; PKC12; PPIASE; rotamase; 12 kDa FKBP; calstabin-1; FKBP12-Exip3; PPIase FKBP1A; immunophilin FKBP12; FK506 binding protein12; FK506-binding protein 1; FK506-binding protein 12; 12 kDa FK506-binding protein; protein kinase C inhibitor 2; FK506-binding protein 1A (12kD); FK506-binding protein, T-cell, 12-kD; FKBP1; PKCI2; FKBP-12; FKBP-1A; |
Gene ID | 2280 |
mRNA Refseq | NM_000801 |
Protein Refseq | NP_000792 |
MIM | 186945 |
UniProt ID | P62942 |
◆ Recombinant Proteins | ||
FKBP1A-057H | Recombinant Human FKBP1A Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
FKBP1A-1372HFL | Recombinant Full Length Human FKBP1A Protein, C-Flag-tagged | +Inquiry |
FKBP1A-1265C | Recombinant Cattle FKBP1A protein, His-tagged | +Inquiry |
FKBP1A-4799HF | Recombinant Full Length Human FKBP1A Protein, GST-tagged | +Inquiry |
FKBP1A-7000H | Recombinant Human FKBP1A, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP1A-6211HCL | Recombinant Human FKBP1A 293 Cell Lysate | +Inquiry |
FKBP1A-6210HCL | Recombinant Human FKBP1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FKBP1A Products
Required fields are marked with *
My Review for All FKBP1A Products
Required fields are marked with *