Recombinant Full Length Human FKBP1A Protein, C-Flag-tagged
Cat.No. : | FKBP1A-1372HFL |
Product Overview : | Recombinant Full Length Human FKBP1A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium. Multiple alternatively spliced variants, encoding the same protein, have been identified. The human genome contains five pseudogenes related to this gene, at least one of which is transcribed. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 11.8 kDa |
AA Sequence : | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVG QRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | FKBP1A FKBP prolyl isomerase 1A [ Homo sapiens (human) ] |
Official Symbol | FKBP1A |
Synonyms | FKBP1; PKC12; PKCI2; FKBP12; PPIASE; FKBP-12; FKBP-1A |
Gene ID | 2280 |
mRNA Refseq | NM_000801.5 |
Protein Refseq | NP_000792.1 |
MIM | 186945 |
UniProt ID | P62942 |
◆ Recombinant Proteins | ||
FKBP1A-916H | Recombinant Human FKBP1A Protein, His (Fc)-Avi-tagged | +Inquiry |
FKBP1A-1372HFL | Recombinant Full Length Human FKBP1A Protein, C-Flag-tagged | +Inquiry |
FKBP1A-1265C | Recombinant Cattle FKBP1A protein, His-tagged | +Inquiry |
FKBP1A-1987H | Recombinant Human FKBP1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FKBP1A-7000H | Recombinant Human FKBP1A, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP1A-6210HCL | Recombinant Human FKBP1A 293 Cell Lysate | +Inquiry |
FKBP1A-6211HCL | Recombinant Human FKBP1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FKBP1A Products
Required fields are marked with *
My Review for All FKBP1A Products
Required fields are marked with *
0
Inquiry Basket