Recombinant Human FLT3LG, StrepII-tagged
Cat.No. : | FLT3LG-254H |
Product Overview : | Purified, full-length human recombinant FLT3L or Fms-related tyrosine kinase 3 ligand protein (amino acids 27-235, 209 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 23.7 kDa. (Accession NP_001450; UniProt P49771) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 27-235, 209 a.a. |
Description : | Flt3L, a homodimer, stimulates the proliferation of early hematopoietic cells by activating FLT3. It synergizes well with a number of other colony stimulating factors and interleukins. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRF VQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQD LLLVE |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >90% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | FLT3LG fms-related tyrosine kinase 3 ligand [ Homo sapiens ] |
Official Symbol | FLT3LG |
Synonyms | FLT3LG; fms-related tyrosine kinase 3 ligand; flt3 ligand; FL; FLT3L; |
Gene ID | 2323 |
mRNA Refseq | NM_001204502 |
Protein Refseq | NP_001191431 |
MIM | 600007 |
UniProt ID | P49771 |
Chromosome Location | 19q13.3 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Pathways in cancer, organism-specific biosystem; |
Function | cytokine activity; protein homodimerization activity; receptor binding; receptor tyrosine kinase binding; |
◆ Recombinant Proteins | ||
FLT3LG-246H | Active Recombinant Human FLT3LG, Fc-tagged | +Inquiry |
FLT3LG-4965HF | Recombinant Full Length Human FLT3LG Protein, GST-tagged | +Inquiry |
FLT3LG-276H | Active Recombinant Human Fms-related Tyrosine Kinase 3 Ligand, HIgG1 Fc-tagged, mutant | +Inquiry |
FLT3LG-275H | Active Recombinant Human Fms-related Tyrosine Kinase 3 Ligand, MIgG2a Fc-tagged | +Inquiry |
FLT3LG-935H | Active Recombinant Human Fms-related Tyrosine Kinase 3 Lligand | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLT3LG-001HCL | Recombinant Human FLT3LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FLT3LG Products
Required fields are marked with *
My Review for All FLT3LG Products
Required fields are marked with *
0
Inquiry Basket