Recombinant Full Length Human FLT3LG Protein, GST-tagged
| Cat.No. : | FLT3LG-4965HF |
| Product Overview : | Human FLT3LG full-length ORF ( NP_001450.2, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 235 amino acids |
| Description : | Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 (see MIM 186910)-positive classical DCs and their CD103 (ITGAE; MIM 604682)-positive tissue counterparts (summary by Sathaliyawala et al., 2010 [PubMed 20933441]).[supplied by OMIM, Jan 2011] |
| Molecular Mass : | 52.8 kDa |
| AA Sequence : | MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FLT3LG fms-related tyrosine kinase 3 ligand [ Homo sapiens ] |
| Official Symbol | FLT3LG |
| Synonyms | FLT3LG; fms-related tyrosine kinase 3 ligand; flt3 ligand; FL; FLT3L; |
| Gene ID | 2323 |
| mRNA Refseq | NM_001204502 |
| Protein Refseq | NP_001191431 |
| MIM | 600007 |
| UniProt ID | P49771 |
| ◆ Recombinant Proteins | ||
| FLT3LG-488H | Recombinant Human FLT3LG Protein | +Inquiry |
| RFL35157MF | Recombinant Full Length Mouse Fms-Related Tyrosine Kinase 3 Ligand(Flt3Lg) Protein, His-Tagged | +Inquiry |
| FLT3LG-916HFL | Active Recombinant Full Length Human FLT3LG Protein, C-Flag-tagged | +Inquiry |
| FLT3LG-156H | Recombinant Human FLT3LG protein, C-His-tagged | +Inquiry |
| FLT3LG-16H | Active Recombinant Human FLT3LG Protein, Animal Free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FLT3LG-001HCL | Recombinant Human FLT3LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLT3LG Products
Required fields are marked with *
My Review for All FLT3LG Products
Required fields are marked with *




