Recombinant Human full-length ATG7, GST-tagged
Cat.No. : | ATG7-127H |
Product Overview : | Recombinant Human full-length ATG7(1 a.a. - 703 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene was identified based on homology to Pichia pastoris GSA7 and Saccharomyces cerevisiae APG7. In the yeast, the protein appears to be required for fusion of peroxisomal and vacuolar membranes. The protein shows homology to the ATP-binding and catalytic sites of the E1 ubiquitin activating enzymes. |
Molecular Mass : | 104.4 kDa |
AA Sequence : | MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAP TPARCCPAIGTLYNTNTLESFKTADKKLLLEQAANEIWESIKSGTALENPVLLNKFLLLTFADLKKYHFYYWFCY PALCLPESLPLIQGPVGLDQRFSLKQIEALECAYDNLCQTEGVTALPYFLIKYDENMVLVSLLKHYSDFFQGQRT KITIGVYDPCNLAQYPGWPLRNFLVLAAHRWSSSFQSVEVVCFRDRTMQGARDVAHSIIFEVKLPEMAFSPDCPK AVGWEKNQKGGMGPRMVNLSECMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLLLGAGTLGCNVARTLM GWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAADRLQKIFPGVNARGFNMSIPMPGHPVNFSSVT LEQARRDVEQLEQLIESHDVVFLLMDTRESRWLPAVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCP NHPVASADLLGSSLFANIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEG GYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSSKVLDQYEREGFNFLAKVFNSSHSF LEDLTGLTLLHQETQAAEIWDMSDDETI |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATG7 autophagy related 7 [ Homo sapiens (human) ] |
Official Symbol | ATG7 |
Synonyms | ATG7; ATG7 autophagy related 7 homolog (S. cerevisiae); APG7 autophagy 7 like (S. cerevisiae) , APG7L; ubiquitin-like modifier-activating enzyme ATG7; DKFZp434N0735; GSA7; hAGP7; autophagy-related protein 7; ATG12-activating enzyme E1 ATG7; ubiquitin activating enzyme E1-like protein; ubiquitin-activating enzyme E1-like protein; APG7L; APG7-LIKE |
Gene ID | 10533 |
mRNA Refseq | NM_006395 |
Protein Refseq | NP_006386 |
MIM | 608760 |
UniProt ID | O95352 |
Chromosome Location | 3p25.3 |
Pathway | Adaptive Immune System; Antigen processing: Ubiquitination & Proteasome degradation; Class I MHC mediated antigen processing & presentation |
Function | Atg12 activating enzyme activity; Atg8 activating enzyme activity; protein binding; protein homodimerization activity |
◆ Recombinant Proteins | ||
ATG7-845R | Recombinant Rat ATG7 Protein | +Inquiry |
ATG7-7833H | Recombinant Human ATG7 protein, GST-tagged | +Inquiry |
ATG7-272R | Recombinant Rhesus Macaque ATG7 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATG7-3478H | Recombinant Human ATG7 protein, His-tagged | +Inquiry |
Atg7-1524M | Recombinant Mouse Atg7 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATG7-8621HCL | Recombinant Human ATG7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATG7 Products
Required fields are marked with *
My Review for All ATG7 Products
Required fields are marked with *
0
Inquiry Basket