Recombinant Human GALNT6 Protein, GST-tagged
Cat.No. : | GALNT6-4704H |
Product Overview : | Human GALNT6 full-length ORF ( NP_009141.2, 1 a.a. - 622 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. The encoded protein is capable of glycosylating fibronectin peptide in vitro and is expressed in a fibroblast cell line, indicating that it may be involved in the synthesis of oncofetal fibronectin. [provided by RefSeq |
Molecular Mass : | 97.6 kDa |
AA Sequence : | MRLLRRRHMPLRLAMVGCAFVLFLFLLHRDVSSREEATEKPWLKSLVSRKDHVLDLMLEAMNNLRDSMPKLQIRAPEAQQTLFSINQSCLPGFYTPAELKPFWERPPQDPNAPGADGKAFQKSKWTPLETQEKEEGYKKHCFNAFASDRISLQRSLGPDTRPPECVDQKFRRCPPLATTSVIIVFHNEAWSTLLRTVYSVLHTTPAILLKEIILVDDASTEEHLKEKLEQYVKQLQVVRVVRQEERKGLITARLLGASVAQAEVLTFLDAHCECFHGWLEPLLARIAEDKTVVVSPDIVTIDLNTFEFAKPVQRGRVHSRGNFDWSLTFGWETLPPHEKQRRKDETYPIKSPTFAGGLFSISKSYFEHIGTYDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKGTSVIARNQVRLAEVWMDSYKKIFYRRNLQAAKMAQEKSFGDISERLQLREQLHCHNFSWYLHNVYPEMFVPDLTPTFYGAIKNLGTNQCLDVGENNRGGKPLIMYSCHGLGGNQYFEYTTQRDLRHNIAKQLCLHVSKGALGLGSCHFTGKNSQVPKDEEWELAQDQLIRNSGSGTCLTSQDKKPAMAPCNPSDPHQLWLFV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GALNT6 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 6 (GalNAc-T6) [ Homo sapiens ] |
Official Symbol | GALNT6 |
Synonyms | GALNT6; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 6 (GalNAc-T6); polypeptide N-acetylgalactosaminyltransferase 6; pp-GaNTase 6; GalNAc transferase 6; polypeptide GalNAc transferase 6; protein-UDP acetylgalactosaminyltransferase 6; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 6; UDP-N-acetyl-alpha-D-galactosamine: polypeptide N-acetylgalactosaminyltransferase 6; GalNAcT6; GALNAC-T6; |
Gene ID | 11226 |
mRNA Refseq | NM_007210 |
Protein Refseq | NP_009141 |
MIM | 605148 |
UniProt ID | Q8NCL4 |
◆ Recombinant Proteins | ||
Galnt6-3144M | Recombinant Mouse Galnt6 Protein, Myc/DDK-tagged | +Inquiry |
GALNT6-22H | Recombinant Human GALNT6 Protein, MYC/DDK-tagged | +Inquiry |
GALNT6-5268HF | Recombinant Full Length Human GALNT6 Protein, GST-tagged | +Inquiry |
GALNT6-6318H | Recombinant Human GALNT6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GALNT6-6189M | Recombinant Mouse GALNT6 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALNT6-6035HCL | Recombinant Human GALNT6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GALNT6 Products
Required fields are marked with *
My Review for All GALNT6 Products
Required fields are marked with *