Recombinant Human GATA1, GST-tagged
Cat.No. : | GATA1-2052H |
Product Overview : | Recombinant Human GATA1(1 a.a. - 413 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein which belongs to the GATA family of transcription factors. The protein plays an important role in erythroid development by regulating the switch of fetal hemoglobin to adult hemoglobin. Mutations in this gene have been associated with X-linked dyserythropoietic anemia and thrombocytopenia. |
Molecular Mass : | 69.2 kDa |
AA Sequence : | MEFPGLGSLGTSEPLPQFVDPALVSSTPESGVFFPSGPEGLDAAASSTAPSTATAAAAALAYYRDAEAYRHSPVF QVYPLLNCMEGIPGGSPYAGWAYGKTGLYPASTVCPTREDSPPQAVEDLDGKGSTSFLETLKTERLSPDLLTLGP ALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLC NACGLYHKMNGQNRPLIRPKKRLIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKD GIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEVASGLTLGPPGTAHLYQGLGPVVLSGP VSHLMPFPGPLLGSPTGSFPTGPMPPTTSTTVVAPLSS |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GATA1 GATA binding protein 1 (globin transcription factor 1) [ Homo sapiens (human) ] |
Official Symbol | GATA1 |
Synonyms | GATA1; GATA binding protein 1 (globin transcription factor 1); GATA binding protein 1 (globin transcription factor 1) , GF1; erythroid transcription factor; ERYF1; GATA 1; NFE1 |
Gene ID | 2623 |
mRNA Refseq | NM_002049 |
Protein Refseq | NP_002040 |
MIM | 305371 |
UniProt ID | P15976 |
Chromosome Location | Xp11.23 |
Pathway | C-MYB transcription factor network; Factors involved in megakaryocyte development and platelet production; Notch-mediated HES/HEY network |
Function | C2H2 zinc finger domain binding; DNA binding, bending; RNA polymerase II core promoter proximal region sequence-specific DNA binding |
◆ Recombinant Proteins | ||
GATA1-6938HF | Recombinant Full Length Human GATA1 Protein, GST-tagged | +Inquiry |
GATA1-3481M | Recombinant Mouse GATA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gata1-474M | Recombinant Mouse Gata1 Protein, His-tagged | +Inquiry |
GATA1-2137R | Recombinant Rat GATA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GATA1-6222M | Recombinant Mouse GATA1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GATA1-689HCL | Recombinant Human GATA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GATA1 Products
Required fields are marked with *
My Review for All GATA1 Products
Required fields are marked with *
0
Inquiry Basket