Recombinant Human GDNF Protein
Cat.No. : | GDNF-150H |
Product Overview : | Recombinant Human Glial Cell Line-Derived Neurotrophic Factor is produced by our E.coli expression system and the target gene encoding Ser78-Ile211 is expressed. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | Ser78-Ile211 |
Description : | Glial Cell Line-Derived Neurotrophic Factor (GDNF) is a disulfide-linked homodimeric glycoprotein that belongs to the TGF-β superfamily. It has been shown to promote the survival of various neuronal subpopulations in both the central as well as the peripheral nervous systems at different stages of their development. Human GDNF cDNA encodes a 211 amino acid residue prepropeptide that is processed to yield a dimeric protein. Mature human GDNF was predicted to contain two 134 amino acid residue subunits. Cells known to express GDNF include Sertoli cells, type 1 astrocytes, Schwann cells, neurons, pinealocytes and skeletal muscle cells. Mutations in this gene may be associated with Hirschsprung disease. |
Form : | Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.25. |
AA Sequence : | SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFR YCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
Endotoxin : | Less than 0.1 ng/ug (1 EU/ug). |
Purity : | >95% |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100μg/ml. Dissolve the lyophilized protein in distilled water. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Quality Statement : | Purity: Greater than 95% as determined by reducing SDS-PAGE. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature listed below. |
Gene Name | GDNF glial cell derived neurotrophic factor [ Homo sapiens (human) ] |
Official Symbol | GDNF |
Synonyms | Glial Cell Line-Derived Neurotrophic Factor; hGDNF; Astrocyte-Derived Trophic Factor; ATF; ATF1; ATF2; HSCR3; HFB1-GDNF |
Gene ID | 2668 |
mRNA Refseq | NM_000514.4 |
Protein Refseq | NP_000505.1 |
MIM | 600837 |
UniProt ID | P39905 |
◆ Recombinant Proteins | ||
GDNF-01H | Recombinant Human GDNF Protein, His-tagged | +Inquiry |
GDNF-4835H | Recombinant Human GDNF Protein, GST-tagged | +Inquiry |
Gdnf-779M | Recombinant Mouse Gdnf protein, His-tagged | +Inquiry |
GDNF-1510H | Recombinant Human GDNF protein | +Inquiry |
GDNF-2437H | Recombinant Human GDNF Protein (Ser78-Gly107), N-His and N-SUMO tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDNF-400RCL | Recombinant Rat GDNF cell lysate | +Inquiry |
GDNF-1549HCL | Recombinant Human GDNF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GDNF Products
Required fields are marked with *
My Review for All GDNF Products
Required fields are marked with *