Recombinant Mouse GDNF Protein
| Cat.No. : | GDNF-109M |
| Product Overview : | Recombinant Mouse GDNF Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Description : | Glial cell-derived neurotrophic factor (GDNF) is a neurotrophic factor that signals through a multicomponent receptor system to activate receptor tyrosine kinase RET signaling. GDNF promotes dopamine uptake, prevents motor neuron apoptosis, and supports the survival and differentiation of neurons. |
| Bio-activity : | No biological activity data is available at this time. |
| Molecular Mass : | Dimer, 15.1/30.2 kDa (135/270 aa) |
| AA Sequence : | MSPDKQAALPRRENRNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
| Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
| Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
| Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
| Storage : | Storage Prior to Reconstitution: -20 centigrade |
| Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
| Reconstitution : | Sterile water at 0.1 mg/mL |
| Shipping : | Room temperature |
| Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
| Gene Name | Gdnf glial cell line derived neurotrophic factor [ Mus musculus (house mouse) ] |
| Official Symbol | GDNF |
| Synonyms | GDNF; glial cell line derived neurotrophic factor; glial cell line-derived neurotrophic factor; ATF; mGDNF; neurotrophic factor; astrocyte-derived trophic factor; AI385739; |
| Gene ID | 14573 |
| mRNA Refseq | NM_010275 |
| Protein Refseq | NP_034405 |
| UniProt ID | P48540 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GDNF Products
Required fields are marked with *
My Review for All GDNF Products
Required fields are marked with *



