Recombinant Mouse GDNF Protein

Cat.No. : GDNF-109M
Product Overview : Recombinant Mouse GDNF Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Glial cell-derived neurotrophic factor (GDNF) is a neurotrophic factor that signals through a multicomponent receptor system to activate receptor tyrosine kinase RET signaling. GDNF promotes dopamine uptake, prevents motor neuron apoptosis, and supports the survival and differentiation of neurons.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Dimer, 15.1/30.2 kDa (135/270 aa)
AA Sequence : MSPDKQAALPRRENRNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Gdnf glial cell line derived neurotrophic factor [ Mus musculus (house mouse) ]
Official Symbol GDNF
Synonyms GDNF; glial cell line derived neurotrophic factor; glial cell line-derived neurotrophic factor; ATF; mGDNF; neurotrophic factor; astrocyte-derived trophic factor; AI385739;
Gene ID 14573
mRNA Refseq NM_010275
Protein Refseq NP_034405
UniProt ID P48540

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GDNF Products

Required fields are marked with *

My Review for All GDNF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon