Recombinant Human GHR, Fc-tagged
Cat.No. : | GHR-28186TH |
Product Overview : | Recombinant fragment, corresponding to extracellular amino acids 19-254 of Human Growth hormone receptor fused to the Fc region of Human IgG1 (aa 93-330). The chimeric protein was expressed in modified human 293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Fc |
Protein Length : | 19-254 a.a. |
Description : | This gene encodes a member of the type I cytokine receptor family, which is a transmembrane receptor for growth hormone. Binding of growth hormone to the receptor leads to receptor dimerization and the activation of an intra- and intercellular signal transduction pathway leading to growth. Mutations in this gene have been associated with Laron syndrome, also known as the growth hormone insensitivity syndrome (GHIS), a disorder characterized by short stature. In humans and rabbits, but not rodents, growth hormone binding protein (GHBP) is generated by proteolytic cleavage of the extracellular ligand-binding domain from the mature growth hormone receptor protein. Multiple alternatively spliced transcript variants have been found for this gene. |
Conjugation : | Fc |
Tissue specificity : | Expressed in various tissues with high expression in liver and skeletal muscle. Isoform 4 is predominantly expressed in kidney, bladder, adrenal gland and brain stem. Isoform 1 expression in placenta is predominant in chorion and decidua. Isoform 4 is hig |
Form : | Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin |
Storage : | Store at +4°C. |
Sequences of amino acids : | Theoretical sequence: FSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKC RSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEW TQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSN GGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHAD IQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLY VTLPQMRIPKVDKKVEPKSCDKTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFN WYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK |
Sequence Similarities : | Belongs to the type I cytokine receptor family. Type 1 subfamily.Contains 1 fibronectin type-III domain. |
Gene Name | GHR growth hormone receptor [ Homo sapiens ] |
Official Symbol | GHR |
Synonyms | GHR; growth hormone receptor; |
Gene ID | 2690 |
mRNA Refseq | NM_000163 |
Protein Refseq | NP_000154 |
MIM | 600946 |
Uniprot ID | P10912 |
Chromosome Location | 5p14-p12 |
Pathway | Androgen Receptor Signaling Pathway, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endochondral Ossification, organism-specific biosystem; |
Function | SH2 domain binding; growth factor binding; growth hormone receptor activity; peptide hormone binding; proline-rich region binding; |
◆ Recombinant Proteins | ||
GHR-2337H | Recombinant Human GHR Protein (Lys315-Thr574), N-His tagged | +Inquiry |
GHR-4887H | Recombinant Human GHR Protein, GST-tagged | +Inquiry |
GHR-555H | Recombinant Human GHR Protein, Biotinylated | +Inquiry |
GHR-6744H | Recombinant Human GHR protein, His-tagged | +Inquiry |
GHR-28186TH | Recombinant Human GHR, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GHR-2401MCL | Recombinant Mouse GHR cell lysate | +Inquiry |
GHR-1140RCL | Recombinant Rat GHR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GHR Products
Required fields are marked with *
My Review for All GHR Products
Required fields are marked with *
0
Inquiry Basket