Recombinant Pig GHR protein, His-tagged
| Cat.No. : | GHR-2960P |
| Product Overview : | Recombinant Pig GHR protein(P19756)(19-264aa), fused to C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pig |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 19-264aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 30.3 kDa |
| AA Sequence : | FSGSEATPAVLVRASQSLQRVHPGLETNSSGKPKFTKCRSPELETFSCHWTDGVRHGLQSPGSIQLFYIRRSTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTSNGGTVDQKCFSVEEIVQPDPPIGLNWTLLNISLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRNSEKYGEFSEVLYVTLPQMSPFACEEDFR |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | GHR growth hormone receptor [ Sus scrofa ] |
| Official Symbol | GHR |
| Synonyms | GHR; growth hormone receptor; GH receptor; somatotropin receptor; |
| Gene ID | 397488 |
| mRNA Refseq | NM_214254 |
| Protein Refseq | NP_999419 |
| ◆ Recombinant Proteins | ||
| GHR-555H | Recombinant Human GHR Protein, Biotinylated | +Inquiry |
| GHR-2184R | Recombinant Rat GHR Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ghr-5766R | Recombinant Rat Ghr protein, His & T7-tagged | +Inquiry |
| GHR-2959R | Recombinant Rhesus macaque GHR protein, His-tagged | +Inquiry |
| GHR-453D | Recombinant Dog GHR protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GHR-1140RCL | Recombinant Rat GHR cell lysate | +Inquiry |
| GHR-2401MCL | Recombinant Mouse GHR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GHR Products
Required fields are marked with *
My Review for All GHR Products
Required fields are marked with *
