Recombinant Human GPC1
Cat.No. : | GPC1-29027TH |
Product Overview : | Recombinant fragment of Human Glypican 1/ GPC1 with N terminal proprietary tag, 37.51kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 108 amino acids |
Description : | Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage.These proteins may play a role in the control of cell division and growth regulation. |
Molecular Weight : | 37.510kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICP QGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQ LRSFDDHFQHLLNDSERTLQATFPGAFG |
Sequence Similarities : | Belongs to the glypican family. |
Gene Name | GPC1 glypican 1 [ Homo sapiens ] |
Official Symbol | GPC1 |
Synonyms | GPC1; glypican 1; glypican-1; glypican; glypican proteoglycan 1; |
Gene ID | 2817 |
mRNA Refseq | NM_002081 |
Protein Refseq | NP_002072 |
MIM | 600395 |
Uniprot ID | P35052 |
Chromosome Location | 2q35-q37 |
Pathway | Activation of Rac, organism-specific biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Glypican 1 network, organism-specific biosystem; Glypican pathway, organism-specific biosystem; |
Function | heparan sulfate proteoglycan binding; |
◆ Recombinant Proteins | ||
GPC1-3059H | Recombinant Human GPC1 Protein (Glu208-Ser530), N-His tagged | +Inquiry |
GPC1-152H | Recombinant Human GPC1 protein, His-tagged | +Inquiry |
GPC1-3058H | Recombinant Human GPC1 Protein (Asp24-Thr529), N-His tagged | +Inquiry |
GPC1-5145H | Recombinant Human GPC1 Protein, GST-tagged | +Inquiry |
GPC1-2286R | Recombinant Rat GPC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPC1 Products
Required fields are marked with *
My Review for All GPC1 Products
Required fields are marked with *
0
Inquiry Basket