Recombinant Human GRP Protein, GST-tagged

Cat.No. : GRP-5379H
Product Overview : Human GRP full-length ORF ( AAH04488, 1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the bombesin-like family of gastrin-releasing peptides. Its preproprotein, following cleavage of a signal peptide, is further processed to produce either the 27 aa gastrin-releasing peptide or the 10 aa neuromedin C. These smaller peptides regulate numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation. These peptides are also likely to play a role in human cancers of the lung, colon, stomach, pancreas, breast, and prostate. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Molecular Mass : 42.02 kDa
AA Sequence : MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GRP gastrin-releasing peptide [ Homo sapiens ]
Official Symbol GRP
Synonyms GRP; gastrin-releasing peptide; bombesin; neuromedin C; pre-progastrin releasing peptide; BN; GRP-10; proGRP; preproGRP;
Gene ID 2922
mRNA Refseq NM_001012512
Protein Refseq NP_001012530
MIM 137260
UniProt ID P07492

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GRP Products

Required fields are marked with *

My Review for All GRP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon