Recombinant Full Length Human GRP Protein, GST-tagged
Cat.No. : | GRP-5602HF |
Product Overview : | Human GRP full-length ORF ( AAH04488, 1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 148 amino acids |
Description : | This gene encodes a member of the bombesin-like family of gastrin-releasing peptides. Its preproprotein, following cleavage of a signal peptide, is further processed to produce either the 27 aa gastrin-releasing peptide or the 10 aa neuromedin C. These smaller peptides regulate numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation. These peptides are also likely to play a role in human cancers of the lung, colon, stomach, pancreas, breast, and prostate. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq |
Molecular Mass : | 42.02 kDa |
AA Sequence : | MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GRP gastrin-releasing peptide [ Homo sapiens ] |
Official Symbol | GRP |
Synonyms | GRP; gastrin-releasing peptide; bombesin; neuromedin C; pre-progastrin releasing peptide; BN; GRP-10; proGRP; preproGRP; |
Gene ID | 2922 |
mRNA Refseq | NM_001012512 |
Protein Refseq | NP_001012530 |
MIM | 137260 |
UniProt ID | P07492 |
◆ Recombinant Proteins | ||
GRP-5379H | Recombinant Human GRP Protein, GST-tagged | +Inquiry |
GRP-7487Z | Recombinant Zebrafish GRP | +Inquiry |
GRP-201H | Recombinant Human GRP Protein, His-ABP-tagged | +Inquiry |
GRP-7545H | Recombinant Human GRP protein, His-tagged | +Inquiry |
GRP-1254H | Recombinant Human GRP protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRP-5730HCL | Recombinant Human GRP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRP Products
Required fields are marked with *
My Review for All GRP Products
Required fields are marked with *