Recombinant Human GRP protein, His-tagged

Cat.No. : GRP-13547H
Product Overview : Recombinant Human GRP protein(1-148 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability January 30, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-148 aa
Tag : N-His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ
Gene Name GRP gastrin-releasing peptide [ Homo sapiens ]
Official Symbol GRP
Synonyms GRP; gastrin-releasing peptide; bombesin; neuromedin C; pre-progastrin releasing peptide; BN; GRP-10; proGRP; preproGRP;
Gene ID 2922
mRNA Refseq NM_001012512
Protein Refseq NP_001012530
MIM 137260
UniProt ID P07492

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GRP Products

Required fields are marked with *

My Review for All GRP Products

Required fields are marked with *

0
cart-icon
0
compare icon