Recombinant Human GSDMC Protein, GST-tagged
Cat.No. : | GSDMC-5402H |
Product Overview : | Human MLZE full-length ORF ( AAH35321.1, 1 a.a. - 508 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GSDMC (Gasdermin C) is a Protein Coding gene. An important paralog of this gene is GSDMA. |
Molecular Mass : | 84.1 kDa |
AA Sequence : | MPSMLERISKNLVKEIGSKDLTSVKYLLSATKLRQFVILRKKKDSRSSFWEQSDYVPVEFSLNDILEPSSSVLETVVTGPFHFSDIMIQKHKADMGVNVGIEVSVSGEASVDHGCSLEFQIVTIPSPNLEDFQKRKLLDPEPSFLKECRRRGDNLYVVTEAVELINNTVLYDSSSVNILGKIALWITYGKGQGQGESLRVKKKALTLQKGMVMAYKRKQLVIKEKAILISDDDEQRTFQDEYEISEMVGYCAARSEGLLPSFHTISPTLFNASSNDMKLKPELFLTQQFLSGHLPKYEQVHILPVGRIEEPFWQNFKHLQEEVFQKIKTLAQLSKDVQDVMFYSILAMLRDRGALQDLMNMLELDSSGHLDGPGGAILKKLQQDSNHAWFNPKDPILYLLEAIMVLSDFQHDLLACSMEKRILLQQQELVRSILEPNFRYPWSIPFTLKPELLAPLQSEGLAITYGLLEECGLRTELDNPRSTWDVEAKMPLSALYGTLSLLQQLAEA |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GSDMC gasdermin C [ Homo sapiens ] |
Official Symbol | GSDMC |
Synonyms | GSDMC; gasdermin C; melanoma derived leucine zipper, extra nuclear factor , MLZE; gasdermin-C; melanoma-derived leucine zipper, extra-nuclear factor; melanoma-derived leucine zipper-containing extranuclear factor; MLZE; |
Gene ID | 56169 |
mRNA Refseq | NM_031415 |
Protein Refseq | NP_113603 |
MIM | 608384 |
UniProt ID | Q9BYG8 |
◆ Recombinant Proteins | ||
GSDMC-6382HF | Recombinant Full Length Human GSDMC Protein, GST-tagged | +Inquiry |
GSDMC-7307M | Recombinant Mouse GSDMC Protein | +Inquiry |
GSDMC-3083H | Recombinant Human GSDMC Protein, His (Fc)-Avi-tagged | +Inquiry |
GSDMC-2758H | Recombinant Human GSDMC Protein (1-508 aa), His-Myc-tagged | +Inquiry |
GSDMC-883H | Recombinant Human GSDMC | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSDMC-5726HCL | Recombinant Human GSDMC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GSDMC Products
Required fields are marked with *
My Review for All GSDMC Products
Required fields are marked with *
0
Inquiry Basket