Recombinant Human GSDMC Protein (1-508 aa), His-Myc-tagged
Cat.No. : | GSDMC-2758H |
Product Overview : | Recombinant Human GSDMC Protein (1-508 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cancer. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 1-508 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 61.7 kDa |
AA Sequence : | MPSMLERISKNLVKEIGSKDLTPVKYLLSATKLRQFVILRKKKDSRSSFWEQSDYVPVEFSLNDILEPSSSVLETVVTGPFHFSDIMIQKHKADMGVNVGIEVSVSGEASVDHGCSLEFQIVTIPSPNLEDFQKRKLLDPEPSFLKECRRRGDNLYVVTEAVELINNTVLYDSSSVNILGKIALWITYGKGQGQGESLRVKKKALTLQKGMVMAYKRKQLVIKEKAILISDDDEQRTFQDEYEISEMVGYCAARSEGLLPSFHTISPTLFNASSNDMKLKPELFLTQQFLSGHLPKYEQVHILPVGRIEEPFWQNFKHLQEEVFQKIKTLAQLSKDVQDVMFYSILAMLRDRGALQDLMNMLELDSSGHLDGPGGAILKKLQQDSNHAWFNPKDPILYLLEAIMVLSDFQHDLLACSMEKRILLQQQELVRSILEPNFRYPWSIPFTLKPELLAPLQSEGLAITYGLLEECGLRMELDNPRSTWDVEAKMPLSALYGTLSLLQQLAEA |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | GSDMC gasdermin C [ Homo sapiens ] |
Official Symbol | GSDMC |
Synonyms | GSDMC; gasdermin C; gasdermin-C; melanoma-derived leucine zipper-containing extranuclear factor; MLZE; |
Gene ID | 56169 |
mRNA Refseq | NM_031415 |
Protein Refseq | NP_113603 |
MIM | 608384 |
UniProt ID | Q9BYG8 |
◆ Recombinant Proteins | ||
GSDMC-7307M | Recombinant Mouse GSDMC Protein | +Inquiry |
GSDMC-3953M | Recombinant Mouse GSDMC Protein, His (Fc)-Avi-tagged | +Inquiry |
GSDMC-883H | Recombinant Human GSDMC | +Inquiry |
GSDMC-2758H | Recombinant Human GSDMC Protein (1-508 aa), His-Myc-tagged | +Inquiry |
GSDMC-3083H | Recombinant Human GSDMC Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSDMC-5726HCL | Recombinant Human GSDMC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSDMC Products
Required fields are marked with *
My Review for All GSDMC Products
Required fields are marked with *
0
Inquiry Basket