Recombinant Human GSTM4, His-tagged
Cat.No. : | GSTM4-27770TH |
Product Overview : | Recombinant full length Human GSTM4 with N terminal His tag; 238aa, 27.7kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 218 amino acids |
Description : | Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individuals susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Diversification of these genes has occurred in regions encoding substrate-binding domains, as well as in tissue expression patterns, to accommodate an increasing number of foreign compounds. Multiple transcript variants, each encoding a distinct protein isoform, have been identified. |
Conjugation : | HIS |
Molecular Weight : | 27.700kDa inclusive of tags |
Tissue specificity : | Expressed in a wide variety of tissues. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK |
Sequence Similarities : | Belongs to the GST superfamily. Mu family.Contains 1 GST C-terminal domain.Contains 1 GST N-terminal domain. |
Gene Name | GSTM4 glutathione S-transferase mu 4 [ Homo sapiens ] |
Official Symbol | GSTM4 |
Synonyms | GSTM4; glutathione S-transferase mu 4; glutathione S transferase M4; glutathione S-transferase Mu 4; |
Gene ID | 2948 |
mRNA Refseq | NM_000850 |
Protein Refseq | NP_000841 |
MIM | 138333 |
Uniprot ID | Q03013 |
Chromosome Location | 1p13 |
Pathway | Biological oxidations, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Glutathione conjugation, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem; |
Function | glutathione transferase activity; transferase activity; |
◆ Recombinant Proteins | ||
Gstm4-1604M | Recombinant Mouse Gstm4 Protein, His-tagged | +Inquiry |
GSTM4-4420H | Recombinant Human GSTM4 Protein, GST-tagged | +Inquiry |
GSTM4-780H | Recombinant Human Glutathione S-transferase Mu 4, His-tagged | +Inquiry |
GSTM4-13577H | Recombinant Human GSTM4, GST-tagged | +Inquiry |
GSTM4-1994R | Recombinant Rhesus monkey GSTM4 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTM4-5711HCL | Recombinant Human GSTM4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GSTM4 Products
Required fields are marked with *
My Review for All GSTM4 Products
Required fields are marked with *
0
Inquiry Basket