Recombinant Human GSTM4, His-tagged

Cat.No. : GSTM4-27770TH
Product Overview : Recombinant full length Human GSTM4 with N terminal His tag; 238aa, 27.7kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 218 amino acids
Description : Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individuals susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Diversification of these genes has occurred in regions encoding substrate-binding domains, as well as in tissue expression patterns, to accommodate an increasing number of foreign compounds. Multiple transcript variants, each encoding a distinct protein isoform, have been identified.
Conjugation : HIS
Molecular Weight : 27.700kDa inclusive of tags
Tissue specificity : Expressed in a wide variety of tissues.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK
Sequence Similarities : Belongs to the GST superfamily. Mu family.Contains 1 GST C-terminal domain.Contains 1 GST N-terminal domain.
Gene Name GSTM4 glutathione S-transferase mu 4 [ Homo sapiens ]
Official Symbol GSTM4
Synonyms GSTM4; glutathione S-transferase mu 4; glutathione S transferase M4; glutathione S-transferase Mu 4;
Gene ID 2948
mRNA Refseq NM_000850
Protein Refseq NP_000841
MIM 138333
Uniprot ID Q03013
Chromosome Location 1p13
Pathway Biological oxidations, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Glutathione conjugation, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem;
Function glutathione transferase activity; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GSTM4 Products

Required fields are marked with *

My Review for All GSTM4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon