Recombinant Human GUK1 Protein, GST-tagged

Cat.No. : GUK1-4495H
Product Overview : Human GUK1 full-length ORF ( AAH06249, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is an enzyme that catalyzes the transfer of a phosphate group from ATP to guanosine monophosphate (GMP) to form guanosine diphosphate (GDP). The encoded protein is thought to be a good target for cancer chemotherapy. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2011]
Molecular Mass : 47.41 kDa
AA Sequence : MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GUK1 guanylate kinase 1 [ Homo sapiens ]
Official Symbol GUK1
Synonyms GUK1; guanylate kinase 1; guanylate kinase; GMP kinase; ATP:GMP phosphotransferase; GMK; FLJ42686; FLJ43710;
Gene ID 2987
mRNA Refseq NM_000858
Protein Refseq NP_000849
MIM 139270
UniProt ID Q16774

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GUK1 Products

Required fields are marked with *

My Review for All GUK1 Products

Required fields are marked with *

0
cart-icon